Loading...
HomeMy WebLinkAbout20260171 110-114 Nelson Ave Site Plan SWPPP Stormwater Pollution Prevention Plan Prepared in accordance with NYS DEC General Permit GP-0-25-001 for: JW Hemmingway PUD Owner/Operator: JW Hemmingway, LLC. 563 North Broadway Saratoga Springs, NY 12866 SWPPP Contact: The LA Group, PC 40 Long Alley Saratoga Springs, NY 12866 (518) 587-8100 SWPPP Preparation Date: February 25, 2026 Stormwater Pollution Prevention Plan JW Hemmingway PUD LA Group Project #: 2021001 Table of Contents 1.0 PERMIT OVERVIEW AND REQUIREMENTS ..................................................................... 4 1.1 PERMIT OVERVIEW ................................................................................................................................... 4 2.0 SWPPP REVIEW, UPDATE ....................................................................................................... 4 2.1 SWPPP REVIEW ....................................................................................................................................... 4 2.2 SWPPP UPDATES/AMENDMENTS ............................................................................................................. 5 3.0 SITE ASSESSMENT, EVALUATION AND PLANNING ....................................................... 5 3.1 PROJECT DESCRIPTION ............................................................................................................................. 5 3.2 PRE-DEVELOPMENT CONDITIONS ............................................................................................................ 6 3.3 PROJECT TYPE .......................................................................................................................................... 6 4.0 EROSION AND SEDIMENT CONTROL ................................................................................. 7 4.1 EROSION AND SEDIMENT CONTROL PRACTICES ...................................................................................... 7 4.2 EROSION AND SEDIMENT CONTROL DRAWINGS ...................................................................................... 7 4.3 CONSTRUCTION SEQUENCE OF OPERATIONS............................................................................................ 7 4.4 EROSION AND SEDIMENT CONTROL PRACTICE MAINTENANCE ............................................................... 8 4.5 EROSION AND SEDIMENT CONTROL INSPECTIONS ................................................................................... 9 4.6 CONTRACTOR SEQUENCE FORM ............................................................................................................. 10 4.7 SPILL PREVENTION PRACTICES .............................................................................................................. 11 4.8 CONSTRUCTION WASTE .......................................................................................................................... 14 4.9 OFFSITE VEHICLE TRACKING ................................................................................................................. 14 4.10 TEMPORARY STABILIZATION FOR FROZEN CONDITIONS ....................................................................... 14 5.0 POST CONSTRUCTION STORMWATER MANAGEMENT DESIGN ............................ 15 5.1 HYDRAULIC AND HYDROLOGIC ANALYSIS ............................................................................................ 15 5.2 NYSDEC DESIGN CRITERIA .................................................................................................................. 15 5.3 CURVE NUMBER AND RAINFALL DATA .................................................................................................. 16 5.4 EXISTING CONDITION ............................................................................................................................. 16 5.5 PROPOSED CONDITION ............................................................................................................................ 16 5.6 PROPOSED STORMWATER FACILITY ....................................................................................................... 16 5.7 PRETREATMENT ...................................................................................................................................... 17 5.8 TREATMENT ............................................................................................................................................ 17 5.9 WATER QUALITY VOLUME (WQV) ........................................................................................................ 17 5.10 RUNOFF REDUCTION VOLUME (RRV) .................................................................................................... 18 5.11 CHANNEL PROTECTION VOLUME (CPV) ................................................................................................ 19 5.12 OVERBANK FLOOD (QP) AND EXTREME FLOOD (QF) ATTENUATION .................................................... 19 6.0 POST CONSTRUCTION STORMWATER MAINTENANCE ............................................ 19 6.1 MAINTENANCE TO BE PERFORMED ........................................................................................................ 19 7.0 CONSTRUCTION WASTE ...................................................................................................... 21 8.0 OFFSITE VEHICLE TRACKING ........................................................................................... 21 9.0 SOIL RESTORATION .............................................................................................................. 21 10.0 SPILL PREVENTION PRACTICES ....................................................................................... 22 11.0 CERTIFICATIONS .................................................................................................................... 26 12.0 DEFINITIONS ............................................................................................................................ 31 Stormwater Pollution Prevention Plan JW Hemmingway PUD LA Group Project #: 2021001 Appendices A Notice of Intent (NOI) & MS4 Acceptance Form B Existing Conditions Watershed Map and HydroCAD Calculations C Proposed Conditions Watershed Map and HydroCAD Calculations D Storm Data E NRCS Web Soil Survey and Soil Investigations F Map Set – Location Map and Construction Drawing G SWPPP Inspection Forms –SWPPP Inspection Report H Other SWPPP Forms – Construction Sequence, SWPPP Plan Changes, Spill Response Form, Stormwater Management Practice Maintenance Log I SPDES General Permit GP-0-25-001 J Historic Preservation/Endangered Species Documentation K Deep Ripping and De-compaction (DEC, 2008) Stormwater Pollution Prevention Plan JW Hemmingway PUD LA Group Project #: 2021001 Page 4 1.0 PERMIT OVERVIEW AND REQUIREMENTS 1.1 Permit Overview This Stormwater Pollution Prevention Plan (SWPPP) is prepared to inform the landowner and construction personnel of the measures to be implemented for controlling runoff and pollutants from the site during and after construction activities. The objective of this plan is to comply with the New York Department of Environmental Conservation (NYSDEC) State Pollutant Discharge Elimination System (SPDES) General Permit for Stormwater Discharges from Construction Activities, Permit No. GP-0-25-001 requirements. Any material conflicts between this plan and the site plans, specification or instructions, must be brought to the attention of the design professional. The project may have other permits and it is the responsibility of the owner and contractor to know and understand all permits. The operator will be issued a bill from New York State for a one hundred and ten dollar ($110.00) annual fee for the open GP-0-25-001 permit. The operator will also be billed by New York State for a one time one hundred and ten dollar ($110.00) per acre fee for the proposed disturbed soil area listed in the NOI, and finally a one time six hundred and seventy five ($675.00) per acre fee for the proposed increased impervious area listed in the NOI. The operator is responsible to maintain onsite in a secure location that is accessible during normal working hours to an individual performing a compliance inspection, the following information: ✓ the Notice of Intent (NOI), ✓ the NYS Department of Environmental Conservation NOI Acknowledgement Letter, ✓ the SWPPP, ✓ a copy of the General Permit (included in the SWPPP), ✓ MS4 SWPPP Acceptance Form (where applicable), and ✓ all inspection reports. Technical standards are detailed in the “New York State Standards and Specifications for Sediment and Erosion and Sediment Control (November 2016)”, as well as illustrated on the Construction Drawings included in Appendix F. The design of post-construction stormwater control practices follows the guidance provided by “New York State Stormwater Management Design Manual.” 2.0 SWPPP REVIEW, UPDATE 2.1 SWPPP Review Applicable Federal, State, and local regulatory agencies that have jurisdiction may elect to review this SWPPP and notify the permittee in writing that the SWPPP does not meet the requirements of their regulations. If the SWPPP needs to be revised, the permittee and the site contractor will make the required modifications within seven Stormwater Pollution Prevention Plan JW Hemmingway PUD LA Group Project #: 2021001 Page 5 days of such notification and submit a written certification to the notifying agency that the changes have been implemented. A copy of the SWPPP will be kept available on site for review by regulatory agencies, engineers, and subcontractors. This Project is in the City of Saratoga Springs, which is a regulated MS4 Community, so a copy of this SWPPP was sent to the City for review. A copy of the signed MS4 Acceptance form is provided in Appendix A of this SWPPP. 2.2 SWPPP Updates/Amendments The permittee identified in this SWPPP shall amend the SWPPP under the following conditions: ✓ Whenever the current provisions prove to be ineffective in minimizing pollutants in stormwater discharge from the site, ✓ Whenever there is a change in design, construction or operation that could have an effect on the discharge of pollutants, ✓ To address issues or deficiencies identified during an inspection by the qualified inspector, the Department or other regulatory authority, ✓ To identify a new subcontractor that will implement any part of the SWPPP, and ✓ To document the final construction conditions. If modifications are required to the post-stormwater management practices and the Project is within a regulated, traditional land use control MS4, the owner or operator of the Project must notify the MS4 in writing of any planned amendments or modifications to the post-construction stormwater management practice component of the SWPPP. Unless otherwise notified by the MS4, the owner or operator shall have the SWPPP amendments or modifications reviewed and accepted by the MS4 prior to commencing construction of the post-construction stormwater management practice. The SWPPP PLAN CHANGES, AUTHORIZATION, AND CHANGE CERTIFICATION form (Appendix H) must be filled out and a copy retained onsite during construction. If modifications are required to the post-stormwater management practices and the Project is not within a Regulated, Traditional Land Use Control MS4, the changes shall be documented in the SWPPP kept onsite. 3.0 SITE ASSESSMENT, EVALUATION AND PLANNING 3.1 Project Description The Project described in this SWPPP is located at 110-114 Nelson Ave, in Saratoga Springs, NY. This project proposes to construct 9 new residences and associated walkways, drives and utilities. See Appendix F for a general site location map and proposed plan. Stormwater Pollution Prevention Plan JW Hemmingway PUD LA Group Project #: 2021001 Page 6 3.2 Pre-Development Conditions The proposed area of work is located on a relatively flat terrain that consists of grass areas and various gravel drives. The site is currently used for parking during the Saratoga Race Track season. 3.3 Project Type This Project is a mix of redevelopment and new development and has been designed in accordance with Chapter 4 and Chapter 9 of the 2024 NYSDEC Stormwater Management Design Manual for construction activities. The introduction of new impervious surface requires erosion and sediment control and post-construction stormwater management practices. 3.4 Project Scope The project proposes the construction of nine (9) new residences and associated impervious hardscapes will disturb 2.06 acres. 3.4 Wetlands, Surface Waters and Hydrology Surface runoff generally flows offsite to the east and west with a portion of the site flowing to low areas on site. The runoff eventually discharges into existing storm infrastructure along Nelson Ave and Frank Sullivan Place. 3.5 Soils According to the Natural Resources Conservation Service (NRCS) Web Soil Survey, the area including and surrounding the Project Site is comprised of Deerfield Loamy Fine Sand “A” and Windsor Loamy Sand. The Soils Reports can be found in Attachment A of the Stormwater Management Report. 3.6 Cultural Resources and Natural Heritage Program Determinations A review of the Cultural Resource Information System (CRIS) shows the Project is adjacent to Union Avenue Historic District. The NYSDEC Environmental Mapper map and a letter from the environmental scientist are included in Appendix J. The NYSDEC Environmental Resource Mapper shows that this project is not within an area of significant natural communities, or rare plants or animals. Correspondence from NYS OPRHP and a copy of the CRIS map are included in Appendix J. Stormwater Pollution Prevention Plan JW Hemmingway PUD LA Group Project #: 2021001 Page 7 4.0 EROSION AND SEDIMENT CONTROL 4.1 Erosion and Sediment Control Practices See the SWPPP plan set for details regarding the Sediment and Erosion Control Practices. Temporary Structural Practices ✓ Silt Fence ✓ Stabilized Construction Access Permanent Structural Controls ✓ Land Grading Temporary Stabilization Practices (including vegetative practices) ✓ Stabilization shall be initiated by the end of the next business day and be completed within 14 days. Permanent Stabilization Practices (including vegetative practices) ✓ Seed and mulch all disturbed areas. Slopes that are 3:1 or steeper should receive a Rolled Erosion Control Product (RECP), sodding, and or hydro- seeding a homogenous mixture of wood fiber mulch with tackifying agent. Refer to the SWPPP Plan Set in Appendix F for detailed information on each practice. 4.2 Erosion and Sediment Control Drawings Erosion and Sediment Control measures are included in the SWPPP Plan Set in Appendix F. 4.3 Construction Sequence of Operations. The project will not disturb more than 5 acres. ✓ Temporary structural erosion controls will be installed prior to earthwork as per the attached plans. ✓ Areas to be undisturbed for more than 14 days will be temporarily stabilized by seeding. ✓ Disturbed areas will be reseeded and mulched immediately after final contours are re-established and no more than 14 days after the completion of construction at that site. ✓ Temporary erosion control devices will not be removed until the area served is stabilized by the growth of vegetation and the area is certified as being stabilized by the Erosion Control Superintendent. Stormwater Pollution Prevention Plan JW Hemmingway PUD LA Group Project #: 2021001 Page 8 Construction Activities Sequence must include major items such as, but not limited to, clearing and grubbing, excavation and grading, utility and infrastructure installation and any other activity resulting in soil disturbance. Include installation of erosion and sediment control practices and timing of installation. Install silt fence and construction entrance Clear site and rough grade Utility installation Begin building construction Begin parking and walk installation Monitor/maintain erosion and sediment control measures Remove erosion and sediment control measures upon stabilization of contributing areas 4.4 Erosion and Sediment Control Practice Maintenance Temporary erosion and sediment control practices shall be maintained frequently during construction. It is the responsibility of the operator to inspect and maintain the temporary controls so that they are working efficiently. The operator shall pay close attention to SWPPP Inspection Reports that advise corrective measures. Captured sediment will have to be removed periodically from each practice for the practice to function properly. Temporary erosion and sediment control practice maintenance needs are listed below: ✓ Silt fence – maintenance shall be performed as needed and material removed when “bulges” develop in the silt fence. ✓ Stabilized construction access – access shall be maintained in a condition which shall prevent tracking. This may require periodic top dressing with additional aggregate. All sediment tracked onto or spilled on public rights of way shall be removed immediately. When necessary, wheels must be cleaned to remove sediment prior to entrance on public rights of way. When washing is required, it shall be done in an area stabilized with aggregate and wash water shall be directed away from streams or wetlands preferably to a broad grassed area or a stormwater pond. Stormwater Pollution Prevention Plan JW Hemmingway PUD LA Group Project #: 2021001 Page 9 ✓ Mulch and seed: replace/repair seed and mulch where seeding has been disturbed. 4.5 Erosion and Sediment Control Inspections A Trained Contractor is responsible for daily inspections of erosion and sediment control practices to ensure that they are being maintained in effective operating condition at all times. ▪ A trained contractor shall be an employee from the contracting company responsible for the implementation of the SWPPP. This person must be onsite when any soil disturbing activities are being conducted. The trained contractor must have received 4 hours of Department endorsed training in proper erosion and sediment control principles from a Soil and Water Conservation District, or other Department endorsed entity. After receiving the initial training, the qualified inspector shall receive 4 hours of training every 3 years. This trained contractor cannot conduct the regular SWPPP compliance inspections unless they meet the qualified inspector qualifications. A Qualified Inspector will perform regular inspections per the schedules below and will be responsible for documenting any deficiencies and the repairs thereof. ▪ A qualified inspector shall conduct an assessment of the site prior to the commencement of construction and certify in an inspection report that the appropriate erosion and sediment controls described in the SWPPP and required by GP-0-25-001 have been adequately installed to ensure overall preparedness of the site for commencement of construction. ▪ This qualified inspector must be a Licensed Professional Engineer, Certified Professional in Erosion and Sediment Control (CPESC), Registered Landscape Architect, or someone working under the direct supervision of, and at the same company as, the licensed Professional Engineer or Registered Landscape Architect, provided they have received 4 hours of Department endorsed training in proper erosion and sediment control principles from a Soil and Water Conservation District, or other Department endorsed entity. After receiving the initial training, the qualified inspector shall receive 4 hours of training every 3 years. ▪ The qualified inspector (as defined by the NYS DEC SPDES regulations) shall make at least one inspection every seven (7) calendar days of erosion control devices and ongoing soil disturbance activities during construction. When more than five (5) acres of soil is disturbed at any one time the qualified inspector will make at least two inspections every seven (7) calendar days, with each inspection separated by a minimum of two (2) full calendar days. Stormwater Pollution Prevention Plan JW Hemmingway PUD LA Group Project #: 2021001 Page 10 ▪ A maintenance inspection report will be completed by the qualified inspector after each inspection. The report form to be completed by the inspector is attached in Appendix G. Reports should be compiled and maintained on-site in the SWPPP 3-ring binder. ▪ For construction sites where soil disturbance activities have been temporarily suspended (e.g. winter shutdown) and temporary stabilization measures have been applied to all disturbed areas, the qualified inspector shall conduct a site inspection at least once every thirty (30) calendar days. ▪ For construction sites where soil disturbance activities have been shut down with partial project completion, the qualified inspector may stop conducting inspections, if all areas disturbed as of the project shutdown date have achieved final stabilization and all post- construction stormwater management practices required for the completed portion of the project have been constructed in conformance with the individual project SWPPP and are operational. ▪ The qualified inspector shall contact the owner/operator at the conclusion of each inspection and inform the owner/operator that a new inspection report has been placed in the SWPPP. It is the contractor’s and the owner/operator’s responsibility to address action items identified in the qualified inspector’s inspection reports in a timely manner. ▪ All measures shall be maintained in good working order; if repair is necessary, it shall be initiated within 24 hours of report. The qualified inspector shall take photographs of any needed repairs and also photograph when the repairs are completed. These photographs will be time and date stamped and attached to the weekly inspection report. ▪ Seeded and planted areas shall be inspected for bare spots, washouts, and healthy growth. If necessary, spot reseeding or sodding shall be implemented. 4.6 Contractor Sequence Form The contractor shall prepare a summary of construction status using the Construction Sequence Form (included in Appendix H) once every month. Significant deviations to the sequence and reasons for those deviations (i.e. weather, subcontractor availability, etc.), shall be noted by the contractor. The schedule shall be used to record the dates for initiation of construction, implementation of erosion control measures, stabilization, etc. A copy of this table shall be maintained at the construction site and updated. Stormwater Pollution Prevention Plan JW Hemmingway PUD LA Group Project #: 2021001 Page 11 4.7 Spill Prevention Practices Good Housekeeping and Material Management Practices The following good housekeeping and material management practices will be followed on site during the construction project to reduce the risk of spills or other accidental exposure of materials and substances to stormwater runoff. ▪ Materials will be brought on site in the minimum quantities required. ▪ All materials stored on site will be stored in a neat, orderly manner in their appropriate containers, and if possible, under a roof or other enclosure. ▪ Products will be kept in their original containers with the original manufacturer’s label. ▪ Substances will not be mixed with one another unless recommended by the manufacturer. ▪ Whenever possible, all of a product will be used up before disposal. ▪ Manufacturer’s recommendations for proper use and disposal will be followed. ▪ The construction manager or his designee will inspect regularly to ensure proper use and disposal of materials on site. ▪ The contractor shall prohibit washing of tools, equipment, and machinery in or within 100 feet of any watercourse or wetland. ▪ All above grade storage tanks are to be protected from vehicle damage by temporary barriers. Inventory for Pollution Prevention Plan The materials and substances listed below are expected to be on-site during construction. ▪ Petroleum for fueling vehicles will be stored in above ground storage tanks. Tanks will either be steel with an enclosure capable of holding 110% of the storage tank volume or of a Con-Store, concrete encased type typically employed by NYSDOT. Hydraulic oil and other oils will be stored in their original containers. Concrete and asphalt will be stored in the original delivery trucks. ▪ Fertilizer may be stored on site in its original container for a short period of time prior to seeding. Original containers will be safely piled on pallets or similar devices to protect from moisture. ▪ Paints and other similar materials will be stored in their original containers and all empty containers will be disposed of in accordance with label directions. ▪ Portable sanitary facilities, which contain chemical disinfectants (deodorants) will be located on-site, with the disinfectants held in the tank of the toilet. Hazardous Products These practices are used to reduce the risks associated with hazardous materials. Stormwater Pollution Prevention Plan JW Hemmingway PUD LA Group Project #: 2021001 Page 12 ▪ Products will be kept in original containers unless they are not re-sealable. ▪ Original labels and material safety data sheets will be retained; they contain important product information. ▪ If surplus product must be disposed of, manufacturers’ or local and State recommended methods for proper disposal will be followed. Spill Prevention The following product specific practices will be followed on site. Petroleum Products: ▪ Construction personnel should be made aware that emergency telephone numbers are located in this SWPPP. ▪ The contractor shall immediately contact NYSDEC in the event of a spill, and shall take all appropriate steps to contain the spill, including construction of a dike around the spill and placing absorbent material over this spill. ▪ The contractor shall instruct personnel that spillage of fuels, oils, and similar chemicals must be avoided and will have arranged with a qualified spill remediation company to serve the site. ▪ Fuels, oils, and chemicals will be stored in appropriate and tightly capped containers. Containers shall not be disposed of on the project site. ▪ Fuels, oils, chemicals, material, equipment, and sanitary facilities will be stored/located away from trees and at least 100 feet from streams, wells, wet areas, and other environmentally sensitive sites. ▪ Dispose of chemical containers and surplus chemicals off the project site in accordance with label directions. ▪ Use tight connections and hoses with appropriate nozzles in all operations involving fuels, lubricating materials or chemicals. ▪ Use funnels when pouring fuels, lubricating materials or chemicals. ▪ Refueling and cleaning of construction equipment will take place in parking areas to provide rapid response to emergency situations. ▪ All on-site vehicles will be monitored for leaks and receive regular preventative maintenance to reduce the chance of leakage. Any vehicle leaking fuel or hydraulic fuel will be immediately scheduled for repairs and use will be discontinued until repairs are made. Fertilizers: ▪ Fertilizer will be stored in its original containers on pallets with water resistant coverings. ▪ Proper delivery scheduling will minimize storage time. ▪ Any damaged containers will be repaired immediately upon discovery and any released fertilizer recovered to the fullest extent practicable. Stormwater Pollution Prevention Plan JW Hemmingway PUD LA Group Project #: 2021001 Page 13 Paints: ▪ All containers will be tightly sealed and stored when not required for use. ▪ Excess paint will not be discharged to the storm water system or wastewater system, but will be properly disposed of according to manufacturers’ instructions or State and local regulations. Concrete Trucks: ▪ Concrete trucks will be allowed to wash out or discharge surplus concrete or drum wash water only at designated locations on site. Asphalt Trucks: ▪ Asphalt trucks shall not discharge surplus asphalt on the site. Spill Control Practices In addition to the good housekeeping and material management practices discussed in the previous sections of this plan, the following practices will be followed for spill prevention and cleanup. The construction manager or site superintendent responsible for the day-to-day site operations will be the spill prevention and cleanup coordinator. He will designate at least three other site personnel who will receive spill prevention and cleanup training. These individuals will each become responsible for a particular phase of prevention and cleanup. The names of responsible spill personnel will be posted in the material storage area and in the onsite construction office or trailer. ▪ Manufacturers’ recommended methods for spill cleanup will be clearly posted and site personnel will be made aware of the procedures and the location of the information and cleanup supplies. Any spill in excess or suspected to be in excess of two gallons will be reported to the NYSDEC Regional Spill Response Unit. Notification to the NYSDEC (1-800-457- 7362) must be completed within two hours of the discovery of the spill. ▪ Materials and equipment necessary for spill cleanup will be kept in the material storage area onsite. Equipment and materials will include but not be limited to absorbent pads, brooms, dust pans, mops, rags, gloves, goggles, activated clay, sand, sawdust, and plastic and metal trash containers specifically for this purpose. ▪ All spills will be cleaned up immediately after discovery. ▪ The spill area will be kept well ventilated and personnel will wear appropriate protective clothing to prevent injury from contact with spilled substance. ▪ Spills of toxic or hazardous material will be reported to the appropriate State or local government agency, regardless of the size. Stormwater Pollution Prevention Plan JW Hemmingway PUD LA Group Project #: 2021001 Page 14 4.8 Construction Waste Waste Materials: All waste materials generated during construction will be disposed at a suitable landfill, or transfer station. Hazardous Waste: The project will not be a generator of hazardous waste and it is not anticipated that any hazardous waste will be generated during construction. If there are any materials generated, a licensed hazardous waste carrier will be contracted to dispose the hazardous material at a suitable disposal site. If hazardous materials are discovered during construction, the work will be stopped until the issue is resolved. Waste: Portable sanitary facilities will be made available to construction personnel and will be serviced regularly. 4.9 Offsite Vehicle Tracking Excavation equipment involved with the construction will remain on the project site and will not regularly egress or ingress the site. Any trucks used to bring in materials or remove materials via municipal paved roads will do so over a stabilized construction entrance. If any off-site vehicle tracking occurs, the contractor will be directed to initiate, street sweeping program in the immediate vicinity of the site. 4.10 Temporary Stabilization for Frozen Conditions The following temporary stabilization measures MUST be performed when construction is occurring during winter/frozen ground conditions. The following requirements do not supersede any other requirements of this SWPPP as they apply to non-frozen ground conditions. ▪ Perimeter erosion control MUST still be installed prior to earthwork disturbance as per this SWPPP. ▪ Any areas that cannot be seeded to turf by October 1 or earlier will receive a temporary seeding. The temporary seeding will consist of winter rye seeded at the rate of 120 pounds per acre (2.5 pounds per 1,000 square feet) or stabilized as per the temporary stabilization for winter construction/frozen conditions. ▪ Any area of disturbance that will remain inactive for a period of 14 consecutive days MUST be mulched. This includes any previously disturbed areas that are covered with snow. ▪ Mulch MUST consist of loose straw applied at the rate of 2 to 3 bales (90 to 100 pounds) per thousand square feet. ▪ Mulch MUST be applied uniformly over the area of bare soil or bare soil that is covered with snow. For the latter condition, mulch MUST be applied on top of snow. ▪ Using a tracked vehicle, mulch MUST be crimped into the bare soil/snow. The tracked vehicle MUST be driven across the mulched areas in at least two directions to maximize crimping of mulch into the soil/snow. Stormwater Pollution Prevention Plan JW Hemmingway PUD LA Group Project #: 2021001 Page 15 ▪ If mulch gets blown off an area to a significant degree, the site inspector WILL require that an area be re-mulched in accordance with Items 2 through 5 above, and this area WILL be included on the inspection checklist for the next inspection. ▪ If a particular area repeatedly experiences loss of mulch due to wind, then the inspector WILL require that an alternative method be used to secure the mulch in place. Such alternatives may include the use of netting, tackifier or other methods deemed appropriate by the inspector. ▪ During periods when snow is melting and/or surface soils are thawing during daytime hours, mulched areas MUST be re-tracked (crimped) as per Item 5 above at least once every seven days, more frequently if directed by the inspector. Additional mulch may be required to obtain complete coverage of an area. Biodegradable erosion control matting may be required on steeper slopes. ▪ Additional stabilization measures for non-frozen ground conditions described in this SWPPP WILL be implemented at the time deemed appropriate by the inspector. During the winter season, if a site has been stabilized and soil disturbing activities have been suspended for the winter, weekly inspections can be suspended. However, monthly inspections must still be conducted. All normal weekly inspections must resume when soil disturbing activities resume. 5.0 POST CONSTRUCTION STORMWATER MANAGEMENT DESIGN 5.1 Hydraulic and Hydrologic Analysis The program utilized for quantifying stormwater runoff rates and volumes was HydroCAD software, produced by Applied Microcomputer Systems of Chocorua, NH. The NRCC and NRCS rainfall distribution curves were utilized to model design storm events. Rainfall distributions for the 1, 10, and 100-year frequency rainfall were analyzed. ✓ Hydrologic/hydraulic analysis for all structural components of the stormwater control system for the applicable design storms (see Appendix B And C). ✓ Comparison of post-development stormwater runoff conditions with pre- development conditions (see Appendix B and C). ✓ Dimensions, material specifications and installation details for each post- construction stormwater control practice (see Appendix F). 5.2 NYSDEC Design Criteria The New York State Stormwater Management Design Manual dated July 2024 (The Manual) has been utilized to develop the stormwater management plan. Stormwater Pollution Prevention Plan JW Hemmingway PUD LA Group Project #: 2021001 Page 16 Attachment D contains detailed calculations for determining and summarizing the required and provided volumes for Water Quality and Runoff Reduction. In general, the required design criteria (WQv and RRv) were calculated for all areas where site disturbance or green infrastructure techniques are proposed. 5.3 Curve Number and Rainfall Data The surface cover for the project area is a mixture of grass and impervious areas. The curve numbers utilized in the modeling were assigned based on cover type and HSG soil classification. The design storms used for pre-development versus post-development comparison were the 1, 10, and 100-year, 24-hour duration, SCS Type II events. The rainfall amounts for these storms, according to NRCC and NRCS, are 2.24, 3.74, and 6.27 inches, respectively. 5.4 Existing Condition The Project area’s existing condition, for which this stormwater management plan is based, consists of grass and existing gravel drives. Under the watershed’s Existing Condition, the majority of the site runoff flows offsite to the east to Nelson Avenue and west to Frank Sullivan Place with a portion of the site flowing to low areas on site. These analysis point has been labeled Analysis Point 1 (AP-1) and Analysis Point 2 (AP-2) respectively for the purposes of this study. AP-1 and AP-2 were utilized in comparing all pre- versus post-runoff conditions. Refer to drawing “W-1 Existing Conditions Watershed Map,” located in Appendix B for more information and existing conditions watershed modeling. 5.5 Proposed Condition In the proposed condition, all stormwater from the Project area will continue to discharge to the same points as in the Existing Condition (AP-1 & AP-2). The flow patterns through the watershed have roughly remained unchanged, as is shown on the drawing “W-2 Proposed Conditions Watershed Map” contained in Appendix C. To meet NYSDEC requirements (see Section 5.2 NYSDEC Design Criteria of this report) multiple drywells, an underground infiltration system and porous pavers were incorporated into the stormwater management design to mitigate the quality and quantity of stormwater runoff discharged from the Project Site. 5.6 Proposed Stormwater Facility The Project is proposing the construction of infiltration chambers (SMP-1), porous pavers (SMP-2) and multiple drywells (SMP-3A-3D). The stormwater management facilities are indicated on the watershed map (W2) and construction plans. Stormwater Pollution Prevention Plan JW Hemmingway PUD LA Group Project #: 2021001 Page 17 5.7 Pretreatment Pretreatment for the water discharging into SMP-1 is provided by an isolator row. 5.8 Treatment Treatment of stormwater discharging into all stormwater management practices is provided via infiltration into the underlying soils. 5.9 Water Quality Volume (WQv) The Water Quality Volume (WQv) requirement is designed to improve water quality sizing to capture and treat 90% of the average annual stormwater runoff volumes. The WQv is directly related to the amount of impervious cover created at a site. The followin g equation is used to determine the water quality storage volume. WQv = (P)(Rv)(A) 12 Where: WQv = Water quality volume (acre/feet) P = 90% Rainfall Event (1.15” for Saratoga Springs) Rv = 0.05 + 0.009(I) where I is percent impervious cover A = Site area in acres The required WQv will be provided by infiltration chambers, porous pavers and drywells in accordance with the SWMDM. The total required WQv for the project is 0.092 ac-ft. Refer to Table 5-1 for a summary of the provided water quality volumes for the Project. Refer to Appendix D for detailed WQv calculations. Table 5-1 Water Quality Volume (WQv) Summary SMP Type Provided (ac-ft) SMP-1 Infiltration Chambers 0.049 SMP-2 Porous Pavers 0.033 SMP-2A Porous Pavers 0.001 SMP-3A Drywell 0.005 SMP-3B Drywell 0.003 SMP-3C Drywell 0.011 SMP-3D Drywell 0.004 SMP-4A Porous Pavement 0.002 SMP-4B Porous Pavement 0.007 Stormwater Pollution Prevention Plan JW Hemmingway PUD LA Group Project #: 2021001 Page 18 SMP-4C Porous Pavement 0.005 TOTAL 0.120 ac-ft 5.10 Runoff Reduction Volume (RRv) Section 4.4 of the Manual states, “Runoff reduction shall be achieved by infiltration, groundwater recharge, reuse, recycle, evaporation/evapotranspiration of 100 percent of the post-development water quality volume. The goal of runoff reduction is to replicate pre-development hydrology by maintaining pre-construction infiltration, peak runoff flow, and discharge volume, as well as minimizing concentrated flow, by application of practices that provide source control treatment in a distributed manner before runoff reaches the collection system.” The Project infiltrates 100% of the post-development water quality volume utilizing green infrastructure and stormwater management practices with RRv capabilities throughout the project. Table 5-2 for a summary of the runoff reduction volumes provided for each green infrastructure practice. Refer to Appendix D for detailed RRv calculations. Table 5-2 Runoff Reduction Volume (RRv) Summary SMP Provided (unit) 5.3.1 Conservation of Natural Areas - 5.3.2 Sheetflow to Riparian Buffers/Filter Strips - 5.3.3 Vegetated Open Swales - 5.3.4 Tree Planting/Tree Box - 5.3.5 Disconnection of Rooftop Runoff - 5.3.6 Stream Daylighting - 5.3.7 Rain Garden - 5.3.8 Green Roof - 5.3.9 Stormwater Planters - 5.3.10 Rain Tanks/Cisterns - 5.3.11 Porous Pavement (SMP-2/4) 0.048 Stormwater Pollution Prevention Plan JW Hemmingway PUD LA Group Project #: 2021001 Page 19 Underground Infiltration (SMP-1) 0.049 Drywells, SMP (3A-3D) 0.023 TOTAL 0.120 (ac-ft) 5.11 Channel Protection Volume (CPv) The channel protection volume requirement has been waved, due to the 1-year post- development peak discharge is less than 2.0 cfs without detention or velocity controls. 5.12 Overbank Flood (Qp) and Extreme Flood (Qf) Attenuation The primary purpose of the Overbank Flood (Qp) control sizing criterion is to prevent an increase in the frequency and magnitude of out-of-bank flooding generated by urban development. It requires attenuation of the 10-year, 24-hour storm to ensure post- development peak discharge rates do not exceed the pre-development condition. The intent of the Extreme Flood (Qf) criteria is to (a) prevent the increased risk of flood damage from large storm events, (b) maintain the boundaries of the pre-development 100-year floodplain, and (c) protect the physical integrity of stormwater management practices. It requires storage and attenuation of the 100-year, 24-hour storm to ensure post-development peak discharge rates do not exceed the pre-development condition. During the 10-year and 100-year 24-hour storm the post-development peak discharge rates do not exceed the pre-development rates. See Table 5-3 of this Report for a comparison of pre- and post-development peak rates. Table 5-3 below provides a summary of the existing conditions versus proposed conditions Qp and Qf attenuation for the Project’s watershed. Table 5-3 Existing Conditions Versus Proposed Conditions Qp and Qf Attenuation Pre Development Post Development 10 year, 24 hour storm (Qp) 1.53 CFS 0.91 CFS 100 year, 24 hour storm (Qf) 2.61 CFS 1.23 CFS 6.0 POST CONSTRUCTION STORMWATER MAINTENANCE 6.1 Maintenance to be Performed JW Hemmingway Home Owners Association (HOA) will be responsible for long-term maintenance of all post construction stormwater management facilities. Post construction stormwater management controls are shown on Construction Drawings included in Appendix F. Stormwater Pollution Prevention Plan JW Hemmingway PUD LA Group Project #: 2021001 Page 20 Post-construction maintenance for this project will consist of regular inspections of permanent stormwater management facilities. These maintenance procedures are essential to assure continual performance of the stormwater management practices on your site. During the inspection and any maintenance activity to the stormwater management practices, the responsible party should fill out an inspection and maintenance log to record that it was done. Specific procedures are as follows. Porous Pavement/Pavers • During the winter, the spreading of sand or other particles for traction cannot be done. If the area is to be plowed of snow, this should be done carefully so as not to upset the permeable pavement. • Areas that receive high volumes of sediment will require frequent maintenance activities, and areas that experience high volumes of vehicular traffic will clog more readily due to soil compaction. Typical maintenance activities for permeable paving are summarized in the table below: Typical Maintenance Activities Associated with Permeable Pavers Activity Schedule Ensure paving area is free of debris Monthly Ensure paving dewaters between storms Monthly and after storms >0.5” Ensure area is clean of sediments Monthly Mow upland and adjacent areas and seed bare areas As needed Vacuum sweep frequently to keep surface free of sediments Typically 3 to 4 times a year Inspect the surface for deterioration or spalling Annually ▪ Generally, routine vacuum sweeping and high-pressure washing (with proper disposal of removed material and wash water) can maintain infiltration rates when clogged or crusted material is removed. Signs can also be posted visibly within a permeable paving area to prevent such activities as resurfacing, the use of abrasives, and to restrict truck parking. Dry Wells ▪ Sediment removal with a vacuum truck should be done at least once a year, preferably after spring runoff and then in early fall, or when they are at 50% capacity, whichever comes first. ▪ The systems should be inspected quarterly for the first year and if there are no problems, the system can be inspected semi-annually after the first year. ▪ If infiltration system does not drain within 72-hours following a rainfall event, then a qualified professional should assess the condition of the system to determine Stormwater Pollution Prevention Plan JW Hemmingway PUD LA Group Project #: 2021001 Page 21 measures required to restore infiltration function, including but not limited to removal of accumulated sediments or reconstruction of the system. Underground Infiltration Chambers ▪ The systems should be inspected quarterly for the first year and if there are no problems, the system can be inspected annually after the first year. ▪ If sediment is accumulating on the bottom of the system, pump in water via a flushing port or observation well and then pump the sediment laden water out via the flushing port or the inlet. This can be done with a vacuum truck. The system may have to be flushed multiple times until it is clean of sediment. ▪ Also, the manifold feeding the pipe storage should be flushed by pumping water in the manhole access and out the flushing port. This should be done during the routine inspection. 7.0 CONSTRUCTION WASTE Waste Materials: All waste materials generated during construction shall be disposed of at a suitable landfill or transfer station. Hazardous Waste: The project will not be a generator of hazardous waste and it is not anticipated that any hazardous waste will be generated during construction. If there are any materials generated, a licensed hazardous waste carrier will be contracted to dispose the hazardous material at a suitable disposal site. If hazardous materials are discovered during construction, the work will be stopped until the issue is resolved. Waste: Portable sanitary facilities shall be made available to construction personnel and will be serviced regularly. 8.0 OFFSITE VEHICLE TRACKING If any off-site vehicle tracking occurs, the contractor will be directed to initiate street sweeping program in the immediate vicinity of the site. 9.0 SOIL RESTORATION Excessively compacted areas and areas of cut and fill on the Project Site shall have soil restoration performed as needed. Attached in Appendix K is “Deep Ripping and De- compaction, (DEC 2008).” The methodology in this document should be followed for specific soil restoration measures, performed in accordance with the Table below: Stormwater Pollution Prevention Plan JW Hemmingway PUD LA Group Project #: 2021001 Page 22 • If compost amendment is required, 2 to 4 inches of screened compost shall be incorporated into the soil. • Prior to application of the deep-ripping and de-compaction, the depth to bedrock or naturally occurring hardpan should be known so that the depth of tillage be adjusted according to those restrictive depths. • Soils with a slope that exceeds 10% shall not have full soil restoration with deep-ripping and de-compaction due to potential for erosion from tilled soil. • Any soil tillage (deep or shallow) shall not be done on soils that are excessively wet, as this will damage the soil. • Any tillage shall not be done within approximately 10’ of the drip-line of any existing established trees. • Any large stones that are unearthed during tillage should be removed from the surface prior to final surface preparation and vegetation establishment. 10.0 SPILL PREVENTION PRACTICES Good Housekeeping and Material Management Practices The following good housekeeping and material management practices shall be followed on site during the construction project to reduce the risk of spills or other accidental exposure of materials and substances to stormwater runoff. Type of Soil Disturbance Comments/Examples Minimal Soil Disturbance Preservation of Natural Features Areas where topsoil is stripped only-no change in grade Clearing and Grubbing HSG A& B HSG C & D apply 6 inches of topsoil Aerate* and apply 6 inches of topsoil HSG A& B HSG C & D Aerate and apply 6 inches of topsoil Apply full Soil Restoration** Areas where Runoff Reduction and/or infiltration practices are applied Keep construction equipment from crossing these areas. To protect newly installed practice from any ongoing construction activities construct a single phase operation fence area. **Per "Deep Ripping and Decopmpaction, DEC 2008" *Aeration includes the use of machines such as tractor-drawn implements with coulters making a narrow slit in the soil, a roller with many spikes making indentations in the soil, or prongs which function like a mini-subsoiler Restoration not permitted Restoration not required Soil Restoration Requirement Restoration not required, but may be applied to enhance the reduction specified for appropriate practices Areas of cut and fill Heavy traffic areas onsite (especially in a zone 5-25 feet around buildings, but not within a 5 foot perimeter around foundation walls) Stormwater Pollution Prevention Plan JW Hemmingway PUD LA Group Project #: 2021001 Page 23 ▪ Materials shall be brought on site in the minimum quantities required. ▪ All materials stored on site shall be stored in a neat, orderly manner in their appropriate containers, and if possible, under a roof or other enclosure. ▪ Products shall be kept in their original containers with the original manufacturer’s label. ▪ Substances shall not be mixed with one another unless recommended by the manufacturer. ▪ Whenever possible, all of a product will be used up before disposal. ▪ Manufacturer’s recommendations for proper use and disposal shall be followed. ▪ The construction manager or his designee shall inspect regularly to ensure proper use and disposal of materials on site. ▪ The contractor shall prohibit washing of tools, equipment, and machinery in or within 100 feet of any watercourse or wetland. ▪ All above grade storage tanks are to be protected from vehicle damage by temporary barriers. Inventory for Pollution Prevention Plan The materials and substances listed below are expected to be on-site during construction. ▪ Petroleum for fueling vehicles will be stored in above ground storage tanks. Tanks will either be steel with an enclosure capable of holding 110% of the storage tank volume or of a Con-Store, concrete encased type typically employed by NYSDOT. Hydraulic oil and other oils will be stored in their original containers. Concrete and asphalt will be stored in the original delivery trucks. ▪ Fertilizer may be stored on site in its original container for a short period of time prior to seeding. Original containers will be safely piled on pallets or similar devices to protect from moisture. ▪ Paints and other similar materials will be stored in their original containers and all empty containers will be disposed of in accordance with label directions. ▪ Portable sanitary facilities, which contain chemical disinfectants (deodorants) will be located on-site, with the disinfectants held in the tank of the toilet. Hazardous Products These practices are used to reduce the risks associated with hazardous materials. ▪ Products will be kept in original containers unless they are not re-sealable. ▪ Original labels and material safety data sheets will be retained; they contain important product information. ▪ If surplus product must be disposed of, manufacturers’ or local and State recommended methods for proper disposal will be followed. Spill Prevention Stormwater Pollution Prevention Plan JW Hemmingway PUD LA Group Project #: 2021001 Page 24 The following product specific practices will be followed on site. Petroleum Products: ▪ Construction personnel should be made aware that emergency telephone numbers are located in this SWPPP. ▪ The contractor shall immediately contact NYSDEC in the event of a spill, and shall take all appropriate steps to contain the spill, including construction of a dike around the spill and placing absorbent material over this spill. ▪ The contractor shall instruct personnel that spillage of fuels, oils, and similar chemicals must be avoided and will have arranged with a qualified spill remediation company to serve the site. ▪ Fuels, oils, and chemicals will be stored in appropriate and tightly capped containers. Containers shall not be disposed of on the project site. ▪ Fuels, oils, chemicals, material, equipment, and sanitary facilities will be stored/located away from trees and at least 100 feet from streams, wells, wet areas, and other environmentally sensitive sites. ▪ Dispose of chemical containers and surplus chemicals off the project site in accordance with label directions. ▪ Use tight connections and hoses with appropriate nozzles in all operations involving fuels, lubricating materials or chemicals. ▪ Use funnels when pouring fuels, lubricating materials or chemicals. ▪ Refueling and cleaning of construction equipment will take place in parking areas to provide rapid response to emergency situations. ▪ All on-site vehicles will be monitored for leaks and receive regular preventative maintenance to reduce the chance of leakage. Any vehicle leaking fuel or hydraulic fuel will be immediately scheduled for repairs and use will be discontinued until repairs are made. Fertilizers: ▪ Fertilizer will be stored in its original containers on pallets with water resistant coverings. ▪ Proper delivery scheduling will minimize storage time. ▪ Any damaged containers will be repaired immediately upon discovery and any released fertilizer recovered to the fullest extent practicable. Paints: ▪ No paints will be used therefore this is not applicable. Concrete: ▪ Concrete trucks will be allowed to wash out or discharge surplus concrete or drum wash water only in concrete washout containment structures at designated locations on site. Stormwater Pollution Prevention Plan JW Hemmingway PUD LA Group Project #: 2021001 Page 25 Spill Control Practices In addition to the good housekeeping and material management practices discussed in the previous sections of this plan, the following practices will be followed for spill prevention and cleanup. The construction manager responsible for the day-to-day site operations will be the spill prevention and cleanup coordinator. He will designate at least three other site personnel who will receive spill prevention and cleanup training. These individuals will each become responsible for a particular phase of prevention and cleanup. The names of responsible spill personnel will be posted in the material storage area and in the onsite construction office or trailer. ▪ Manufacturers’ recommended methods for spill cleanup will be clearly posted and site personnel will be made aware of the procedures and the location of the information and cleanup supplies. ▪ Petroleum spills must be reported to DEC unless they meet all the following criteria: o The spill is known to be less than 5 gallons; and o The spill is contained and under the control of the spiller; and o The spill has not and will not reach the State’s water or any land; and o The spill is cleaned up within 2 hours of discovery. ▪ All reportable petroleum spills and most hazardous materials spills must be reported to DEC hotline (1-800-457-7362) within New York State; and (1-518 457-7362) from outside New York State. For spills not deemed reportable, it is strongly recommended that the facts concerning the incident be documented by the spiller and a record maintained for one year. ▪ Materials and equipment necessary for spill cleanup will be kept in the material storage area onsite. Equipment and materials will include but not be limited to absorbent pads, brooms, dust pans, mops, rags, gloves, goggles, activated clay, sand, sawdust, and plastic and metal trash containers specifically for this purpose. ▪ All spills will be cleaned up immediately after discovery. ▪ The spill area will be kept well-ventilated and personnel will wear appropriate protective clothing to prevent injury from contact with spilled substance. ▪ Spills of toxic or hazardous material will be reported to the appropriate State or local government agency, regardless of the size Stormwater Pollution Prevention Plan JW Hemmingway PUD LA Group Project #: 2021001 Page 26 11 .0 CERTIFICATIONS Preparer Certification of Compliance with Federal, State, and Local Regulations This Stormwater Pollution Prevention Plan was prepared in accordance with the New York State Department of Environmental Conservation SPDES General Permit for Stormwater Discharges from Construction Activities (Permit No. GP-0-25-001), pursuant to Article 17, Titles 7, 8 and Article 70 of the Environmental Conservation Law. This SPDES General Permit implements the Federal Clean Water Act pertaining to stormwater discharges. Name: Title: Signature: Date: Company Name: The LA Group, PC Owner Pollution Prevention Plan Certification I certify under penalty of law that this document and all attachments were prepared under my direction or supervision to assure that qualified personnel properly gathered and evaluated the information submitted. Based on my inquiry of the person or persons who are directly responsible for gathering the information, the information submitted is, to the best of my knowledge and belief, true, accurate, and complete. I am aware that false statements made herein are punishable as a Class A misdemeanor pursuant to Section 210.45 of the Penal Law. I understand that GP-0-25-001 requires site inspections be conducted by a qualified professional once every seven (7) days and when approved in writing by the NYSDEC, disturbances of greater than five (5) acres at one time require site inspections two (2) times every seven (7) days. These inspections shall be performed by a qualified professional as defined by the General Permit. The Owner/Operator will be held financially responsible for any and all fines related to work tasks that are not specified by the Contractor(s)/Subcontractor(s) below. Name: Title: Owner/Operator Signature: Date: Company Name: Stormwater Pollution Prevention Plan JW Hemmingway PUD LA Group Project #: 2021001 Page 27 Contractor and Subcontractor Certification I hereby certify under penalty of law that I understand and agree to comply with the terms and conditions of the SWPPP and agree to implement any corrective actions identified by the qualified inspector during a site inspection. I also understand that the permittee must comply with the terms and conditions of the SPDES permit specific to the individual project site and that it is unlawful for any person to cause or contribute to a violation of water quality standards. A person is guilty of making a punishable false written statement when he knowingly makes a false statement, which he does not believe to be true, in a written instrument bearing a legally authorized form notice to the effect that false statements made therein are punishable. Making a punishable false written statement is a class A misdemeanor. Name Title Signature Date Company Name Address City, State, Zip Phone Number SWPPP Components You Are Responsible For 1. 2. 3. 4. 5. 6. Name of Trained Individual Responsible for SWPPP Implementation Title Signature of Trained Individual Responsible for SWPPP Implementation Date Stormwater Pollution Prevention Plan JW Hemmingway PUD LA Group Project #: 2021001 Page 28 Contractor and Subcontractor Certification I hereby certify under penalty of law that I understand and agree to comply with the terms and conditions of the SWPPP and agree to implement any corrective actions identified by the qualified inspector during a site inspection. I also understand that the permittee must comply with the terms and conditions of the SPDES permit specific to the individual project site and that it is unlawful for any person to cause or contribute to a violation of water quality standards. A person is guilty of making a punishable false written statement when he knowingly makes a false statement, which he does not believe to be true, in a written instrument bearing a legally authorized form notice to the effect that false statements made therein are punishable. Making a punishable false written statement is a class A misdemeanor. Name Title Signature Date Company Name Address City, State, Zip Phone Number SWPPP Components You Are Responsible For 1. 2. 3. 4. 5. 6. Name of Trained Individual Responsible for SWPPP Implementation Title Signature of Trained Individual Responsible for SWPPP Implementation Date Stormwater Pollution Prevention Plan JW Hemmingway PUD LA Group Project #: 2021001 Page 29 Contractor and Subcontractor Certification I hereby certify under penalty of law that I understand and agree to comply with the terms and conditions of the SWPPP and agree to implement any corrective actions identified by the qualified inspector during a site inspection. I also understand that the permittee must comply with the terms and conditions of the SPDES permit specific to the individual project site and that it is unlawful for any person to cause or contribute to a violation of water quality standards. A person is guilty of making a punishable false written statement when he knowingly makes a false statement, which he does not believe to be true, in a written instrument bearing a legally authorized form notice to the effect that false statements made therein are punishable. Making a punishable false written statement is a class A misdemeanor. Name Title Signature Date Company Name Address City, State, Zip Phone Number SWPPP Components You Are Responsible For 1. 2. 3. 4. 5. 6. Name of Trained Individual Responsible for SWPPP Implementation Title Signature of Trained Individual Responsible for SWPPP Implementation Date Stormwater Pollution Prevention Plan JW Hemmingway PUD LA Group Project #: 2021001 Page 30 Contractor and Subcontractor Certification I hereby certify under penalty of law that I understand and agree to comply with the terms and conditions of the SWPPP and agree to implement any corrective actions identified by the qualified inspector during a site inspection. I also understand that the permittee must comply with the terms and conditions of the SPDES permit specific to the individual project site and that it is unlawful for any person to cause or contribute to a violation of water quality standards. A person is guilty of making a punishable false written statement when he knowingly makes a false statement, which he does not believe to be true, in a written instrument bearing a legally authorized form notice to the effect that false statements made therein are punishable. Making a punishable false written statement is a class A misdemeanor. Name Title Signature Date Company Name Address City, State, Zip Phone Number SWPPP Components You Are Responsible For 1. 2. 3. 4. 5. 6. Name of Trained Individual Responsible for SWPPP Implementation Title Signature of Trained Individual Responsible for SWPPP Implementation Date Stormwater Pollution Prevention Plan JW Hemmingway PUD LA Group Project #: 2021001 Page 31 12.0 DEFINITIONS Construction Activity(ies) - means any clearing, grading, excavation, filling, demolition, or stockpiling activities that result in soil disturbance. Clearing activities can include, but are not limited to, logging equipment operation, the cutting and skidding of trees, tree removal, stump removal and/or brush removal. Construction activity does not include routine maintenance that is performed to maintain the original line and grade, hydraulic capacity, or original purpose of a facility. Construction Phasing Plan - a plan designed to construct particular portions of an individual project at different times. Phasing is often used when a project is very large to limit the disturbance at a single time to 5 acres per phase. Erosion and Sediment Control Practices – temporary measures installed prior to construction and maintained during construction to temporarily treat any stormwater runoff. Once construction is completed and post-construction stormwater management practices are installed and the site is stabilized, the erosion and sediment control practices are removed from the site. Final Stabilization - means that all soil disturbance activities have ceased and a uniform, perennial vegetative cover with a density of eighty (80) percent over the entire pervious surface has been established; or other equivalent stabilization measures, such as permanent landscape mulches, rock rip-rap or washed/crushed stone have been applied on all disturbed areas that are not covered by permanent structures, concrete pavement. Impervious Area (Cover) - means all impermeable surfaces that cannot effectively infiltrate rainfall. This includes paved, concrete and compacted gravel surfaces (i.e. parking lots, driveways, roads, runways, and sidewalks); building rooftops, and miscellaneous impermeable structures such as patios, pools, and sheds. Owner or Operator – means the person, persons or legal entity which owns or leases the property on which the construction activity is occurring; and/or an entity that has operational control over the construction plans and specifications, including the ability to make modifications to the plans and specifications. Post-Construction Stormwater Management Practices – permanent devices constructed or installed onsite to treat stormwater from a site when construction is completed. Qualified Inspector - means a person that is knowledgeable in the principles and practices of erosion and sediment control, such as a licensed Professional Engineer, Certified Professional in Erosion and Sediment Control (CPESC), Registered Landscape Architect, New York State Erosion and Sediment Control Certificate Program holder or other Department endorsed individual(s). It can also mean someone working under the direct supervision of, and at the same company as, the licensed Professional Engineer or Registered Landscape Architect, provided that person has training in the principles and practices of erosion and sediment Stormwater Pollution Prevention Plan JW Hemmingway PUD LA Group Project #: 2021001 Page 32 control. Training in the principles and practices of erosion and sediment control means that the individual working under the direct supervision of the licensed Professional Engineer or Registered Landscape Architect has received four (4) hours of Department endorsed training in proper erosion and sediment control principles from a Soil and Water Conservation District, or other Department endorsed entity. After receiving the initial training, the individual working under the direct supervision of the licensed Professional Engineer or Registered Landscape Architect shall receive four (4) hours of training every three (3) years. It can also mean a person that meets the Qualified Professional qualifications in addition to the Qualified Inspector qualifications. Note: Inspections of any post-construction stormwater management practices that include structural components, such as a dam for an impoundment, shall be performed by a licensed Professional Engineer. Qualified Professional - means a person that is knowledgeable in the principles and practices of stormwater management and treatment, such as a licensed Professional Engineer, Registered Landscape Architect or other Department endorsed individual(s). Individuals preparing SWPPPs that require the post-construction stormwater management practice component must have an understanding of the principles of hydrology, water quality management practice design, water quantity control design, and, in many cases, the principles of hydraulics. All components of the SWPPP that involve the practice of engineering, as defined by the NYS Education Law (see Article 145), shall be prepared by, or under the direct supervision of, a professional engineer licensed to practice in the State of New York. State Pollutant Discharge Elimination System (SPDES) – means the system established pursuant to Article 17 of the Environmental Conservation Law (ECL) and 6 NYCRR Part 750 for issuance of permits authorizing discharges to the waters of the state. Stormwater Pollution Prevention Plan (SWPPP) - means a project specific report, including construction drawings, that among other things: describes the construction activity(ies), identifies the potential sources of pollution at the construction site; describes and shows the stormwater controls that will be used to control the pollutants (i.e. erosion and sediment controls; for many projects, includes post-construction stormwater management controls); and identifies procedures the permittee will implement to comply with the terms and conditions of the permit. See Part III of the permit for a complete description of the information that must be included in the SWPPP. Surface Waters of the State - shall be construed to include lakes, bays, sounds, ponds, impounding reservoirs, springs, rivers, streams, creeks, estuaries, marshes, inlets, canals, the Atlantic Ocean, within the territorial seas of the state of New York and all other bodies of surface water, natural or artificial, inland or coastal, fresh or salt, public or private (except those private waters that do not combine or effect a junction with natural surface or underground waters), which are wholly or partially within or bordering the state or within its jurisdiction. Waters of the state are further defined in 6 NYCRR Parts 800-941. Stormwater Pollution Prevention Plan JW Hemmingway PUD LA Group Project #: 2021001 Page 33 Temporary Stabilization – means that exposed soil has been covered with material(s) as set forth in the technical standard, New York Standards and Specifications for Erosion and Sediment Control, to prevent the exposed soil from eroding. The materials can include, but are not limited to, mulch, seed and mulch, and erosion control mats (e.g. jute twisted yarn, excelsior wood fiber mats). Trained Contractor – means an employee from a contracting (construction) company responsible for the day to day implementation of the SWPPP. The trained contractor must have received four (4) hours of Department endorsed training in proper erosion and sediment control principles from a Soil and Water Conservation District, or other Department endorsed entity. After receiving the initial training, the qualified inspector shall receive four (4) hours of training every three (3) years. It can also mean an employee from the contracting (construction) company that meets the qualified inspector qualifications (e.g. licensed Professional Engineer, Certified Professional in Erosion and Sediment Control (CPESC), Registered Landscape Architect, New York State Erosion and Sediment Control Certificate Program holder, or someone working under the direct supervision of, and at the same company as, the licensed Professional Engineer or Registered Landscape Architect, provided they have received four (4) hours of Department endorsed training in proper erosion and sediment control principles from a Soil and Water Conservation District, or other Department endorsed entity). The trained contractor is responsible for the day-to-day implementation of the SWPPP. Appendix A Notice of Intent (NOI) & MS4 Acceptance Form NOI for coverage under Stormwater General Permit for Construction Activity version 1.44 (Submission #: HQG-2K7M-F2HRY, version 1) Details Originally Started By Brett Strom Alternate Identifier JW Hemmingway PUD Submission ID HQG-2K7M-F2HRY Status Draft Form Input Owner/Operator Information The previous version of the Construction General Permit (CGP), GP-0-20-001, expired on January 28, 2025, and therefore this GP-0-20-001 eNOI form cannot be used to obtain CGP coverage. Instead, the GP-0-25-001 eNOI form must be used to obtain coverage under the currently effective CGP, GP-0-25-001, which is effective as of January 29, 2025, with an expiration date of January 28, 2030. In nForm, the name of the GP-0-25- 001 eNOI that must be used is: Construction General Permit (CGP) Electronic Notice of Intent (eNOI) GP-0-25-001 Please see the CGP Webpage for further information: https://dec.ny.gov/environmental-protection/water/water- quality/stormwater/construction-activity-permit 2/24/26, 3:37 PM NYSDEC eBusiness Portal System - NOI for coverage under Stormwater General Permit for Construction Activity. Revision 1 https://nform-prod.dec.ny.gov/app/#/submissionwizard/d2faca91-9caa-46ea-b0f5-6891f386c548/10 1/19 Owner/Operator Name (Company/Private Owner/Municipality/Agency/Institution, etc.) JW Hemmingway LLC Owner/Operator Contact Person Last Name (NOT CONSULTANT) Witt Owner/Operator Contact Person First Name John Owner/Operator Mailing Address 563 North Broadway City Saratoga Springs State NY Zip 12866 Phone 5185874113 Email jwitt@wittconstruction.com Federal Tax ID 87-3767009 If the owner/operator is an organization, provide the Federal Tax ID number, or Employer Identification Number (EIN), in the format xx-xxxxxxx. If the owner/operator is an individual and not an organization, enter "Not Applicable" or "N/A" and do not provide the individual’s social security number. 2/24/26, 3:37 PM NYSDEC eBusiness Portal System - NOI for coverage under Stormwater General Permit for Construction Activity. Revision 1 https://nform-prod.dec.ny.gov/app/#/submissionwizard/d2faca91-9caa-46ea-b0f5-6891f386c548/10 2/19 Project Location Project/Site Name JW Hemmingway PUD Street Address (Not P.O. Box) 110-114 Nelson Avenue West City/Town/Village (THAT ISSUES BUILDING PERMIT) Saratoga Springs NY Zip 12866 5 The DEC Region must be provided. Please use the NYSDEC Stormwater Interactive Map (https://gisservices.dec.ny.gov/gis/stormwater/) to confirm which DEC Region this site is located in. To view the DEC Regions, click on “Other Useful Reference Layers” on the left side of the map, then click on “DEC Administrative Boundary.” Zoom out as needed to see the Region boundaries. For projects that span multiple Regions, please select a primary Region and then provide the additional Regions as a note in Question 39. SARATOGA Name of Nearest Cross Street Frank Sullivan Place Side of Street State DEC Region County 2/24/26, 3:37 PM NYSDEC eBusiness Portal System - NOI for coverage under Stormwater General Permit for Construction Activity. Revision 1 https://nform-prod.dec.ny.gov/app/#/submissionwizard/d2faca91-9caa-46ea-b0f5-6891f386c548/10 3/19 Distance to Nearest Cross Street (Feet) 125 North Tax Map Numbers Section-Block-Parcel 166.77-4-17.1 Tax Map Numbers If the project does not have tax map numbers (e.g. linear projects), enter “Not Applicable” or "N/A". 1. Coordinates Provide the Geographic Coordinates for the project site. The two methods are: - Navigate to the project location on the map (below) and click to place a marker and obtain the XY coordinates. - The "Find Me" button will provide the lat/long for the person filling out this form. Then pan the map to the correct location and click the map to place a marker and obtain the XY coordinates. Navigate to your location and click on the map to get the X,Y coordinates 43.07287712067527,-73.77369049562988 Project Details Redevelopment with increase in impervious area Project In Relation to Cross Street NONE PROVIDED 2. What is the nature of this project? 2/24/26, 3:37 PM NYSDEC eBusiness Portal System - NOI for coverage under Stormwater General Permit for Construction Activity. Revision 1 https://nform-prod.dec.ny.gov/app/#/submissionwizard/d2faca91-9caa-46ea-b0f5-6891f386c548/10 4/19 For the purposes of this eNOI, “New Construction” refers to any project that does not involve the disturbance of existing impervious area (i.e. 0 acres). If existing impervious area will be disturbed on the project site, it is considered redevelopment with either increase in impervious area or no increase in impervious area. 3. Select the predominant land use for both pre and post development conditions. Pasture/Open Land Multifamily Residential 3a. If Single Family Subdivision was selected in question 3, enter the number of subdivision lots. 4. In accordance with the larger common plan of development or sale, enter the total project site acreage, the acreage to be disturbed and the future impervious area (acreage)within the disturbed area. *** ROUND TO THE NEAREST TENTH OF AN ACRE. *** Total Site Area (acres) 2.1 Total Area to be Disturbed (acres) 2.1 Existing Impervious Area to be Disturbed (acres) 0.4 Future Impervious Area Within Disturbed Area (acres) 1.3 No Pre-Development Existing Landuse Post-Development Future Land Use NONE PROVIDED 5. Do you plan to disturb more than 5 acres of soil at any one time? 2/24/26, 3:37 PM NYSDEC eBusiness Portal System - NOI for coverage under Stormwater General Permit for Construction Activity. Revision 1 https://nform-prod.dec.ny.gov/app/#/submissionwizard/d2faca91-9caa-46ea-b0f5-6891f386c548/10 5/19 6. Indicate the percentage (%) of each Hydrologic Soil Group(HSG) at the site. A (%) 100 B (%) 0 C (%) 0 D (%) 0 No 8. Enter the planned start and end dates of the disturbance activities. Start Date 05/01/2026 End Date 05/01/2027 9. Identify the nearest surface waterbody(ies) to which construction site runoff will discharge. Unnamed stream offsite Drainage ditches and storm sewer systems are not considered surface waterbodies. Please identify the surface waterbody that they discharge to. If the nearest surface waterbody is unnamed, provide a description of the waterbody, such as, “Unnamed tributary to Niagara River.” Stream/Creek Off Site 7. Is this a phased project? 9a. Type of waterbody identified in question 9? 2/24/26, 3:37 PM NYSDEC eBusiness Portal System - NOI for coverage under Stormwater General Permit for Construction Activity. Revision 1 https://nform-prod.dec.ny.gov/app/#/submissionwizard/d2faca91-9caa-46ea-b0f5-6891f386c548/10 6/19 Other Waterbody Type Off Site Description No No No Please use the DEC Stormwater Interactive Map (https://gisservices.dec.ny.gov/gis/stormwater/) to confirm if this site is located in one of the watersheds of an AA or AA-S classified water. To view the watershed areas, click on “Permit Related Layers” on the left side of the map, then click on “Class AA AAS Watersheds.” If No, skip question 13. If Yes, what is the acreage to be disturbed? No Yes NONE PROVIDED 9b. If "wetland" was selected in 9A, how was the wetland identified? NONE PROVIDED 10. Has the surface waterbody(ies) in question 9 been identified as a 303(d) segment in Appendix E of GP-0-20-001? 11. Is this project located in one of the Watersheds identified in Appendix C of GP-0-20-001? 12. Is the project located in one of the watershed areas associated with AA and AA-S classified waters? 13. Does this construction activity disturb land with no existing impervious cover and where the Soil Slope Phase is identified as D (provided the map unit name is inclusive of slopes greater than 25%), E or F on the USDA Soil Survey? NONE PROVIDED NONE PROVIDED 14. Will the project disturb soils within a State regulated wetland or the protected 100 foot adjacent area? 15. Does the site runoff enter a separate storm sewer system (including roadside drains, swales, ditches, culverts, etc)? 2/24/26, 3:37 PM NYSDEC eBusiness Portal System - NOI for coverage under Stormwater General Permit for Construction Activity. Revision 1 https://nform-prod.dec.ny.gov/app/#/submissionwizard/d2faca91-9caa-46ea-b0f5-6891f386c548/10 7/19 16. What is the name of the municipality/entity that owns the separate storm sewer system? City of Saratoga Springs No No No No Required SWPPP Components Yes Yes If you answered No in question 22, skip question 23 and the Post-construction Criteria and Post-construction SMP Identification sections. Yes Professional Engineer (P.E.) 17. Does any runoff from the site enter a sewer classified as a Combined Sewer? 18. Will future use of this site be an agricultural property as defined by the NYS Agriculture and Markets Law? 19. Is this property owned by a state authority, state agency, federal government or local government? 20. Is this a remediation project being done under a Department approved work plan? (i.e. CERCLA, RCRA, Voluntary Cleanup Agreement, etc.) 21. Has the required Erosion and Sediment Control component of the SWPPP been developed in conformance with the current NYS Standards and Specifications for Erosion and Sediment Control (aka Blue Book)? 22. Does this construction activity require the development of a SWPPP that includes the post-construction stormwater management practice component (i.e. Runoff Reduction, Water Quality and Quantity Control practices/techniques)? 23. Has the post-construction stormwater management practice component of the SWPPP been developed in conformance with the 2015 or 2024 NYS Stormwater Management Design Manual? 24. The Stormwater Pollution Prevention Plan (SWPPP) was prepared by: 2/24/26, 3:37 PM NYSDEC eBusiness Portal System - NOI for coverage under Stormwater General Permit for Construction Activity. Revision 1 https://nform-prod.dec.ny.gov/app/#/submissionwizard/d2faca91-9caa-46ea-b0f5-6891f386c548/10 8/19 SWPPP Preparer The LA Group Contact Name (Last, First) Brett Strom Mailing Address 40 Long Alley City Saratoga Springs State NY Zip 12866 Phone 5185878100 Email bstrom@thelagroup.com Download SWPPP Preparer Certification Form Please take the following steps to prepare and upload your preparer certification form: 1) Click on the link below to download a blank certification form 2) The certified SWPPP preparer should sign this form 3) Scan the signed form 4) Upload the scanned document Download SWPPP Preparer Certification Form Please upload the SWPPP Preparer Certification Comment NONE PROVIDED NONE PROVIDED 2/24/26, 3:37 PM NYSDEC eBusiness Portal System - NOI for coverage under Stormwater General Permit for Construction Activity. Revision 1 https://nform-prod.dec.ny.gov/app/#/submissionwizard/d2faca91-9caa-46ea-b0f5-6891f386c548/10 9/19 Erosion & Sediment Control Criteria Yes 26. Select all of the erosion and sediment control practices that will be employed on the project site: Silt Fence Stabilized Construction Entrance Storm Drain Inlet Protection None Mulching Seeding Sodding None Other Post-Construction Criteria * IMPORTANT: Completion of Questions 27-39 is not required if response to Question 22 is No. Preservation of Buffers 25. Has a construction sequence schedule for the planned management practices been prepared? Temporary Structural Biotechnical Vegetative Measures Permanent Structural NONE PROVIDED 27. Identify all site planning practices that were used to prepare the final site plan/layout for the project. 2/24/26, 3:37 PM NYSDEC eBusiness Portal System - NOI for coverage under Stormwater General Permit for Construction Activity. Revision 1 https://nform-prod.dec.ny.gov/app/#/submissionwizard/d2faca91-9caa-46ea-b0f5-6891f386c548/10 10/19 All disturbed areas will be restored in accordance with the Soil Restoration requirements in Table 5.3 of the Design Manual (see page 5-22). 28. Provide the total Water Quality Volume (WQv) required for this project (based on final site plan/layout). (Acre-feet) 0.092 29. Post-construction SMP Identification Use the Post-construction SMP Identification section to identify the RR techniques (Area Reduction), RR techniques(Volume Reduction) and Standard SMPs with RRv Capacity that were used to reduce the Total WQv Required (#28). Identify the SMPs to be used by providing the total impervious area that contributes runoff to each technique/practice selected. For the Area Reduction Techniques, provide the total contributing area (includes pervious area) and, if applicable, the total impervious area that contributes runoff to the technique/practice. Note: Redevelopment projects shall use the Post-Construction SMP Identification section to identify the SMPs used to treat and/or reduce the WQv required. If runoff reduction techniques will not be used to reduce the required WQv, skip to question 33a after identifying the SMPs. 30. Indicate the Total RRv provided by the RR techniques (Area/Volume Reduction) and Standard SMPs with RRv capacity identified in question 29. (acre-feet) 0.120 Yes If Yes, go to question 36. If No, go to question 32. 32. Provide the Minimum RRv required based on HSG. [Minimum RRv Required = (P) (0.95) (Ai) / 12, Ai=(s) (Aic)] (acre- feet) If Yes, go to question 33. 27a. Indicate which of the following soil restoration criteria was used to address the requirements in Section 5.1.6("Soil Restoration") of the Design Manual. 31. Is the Total RRv provided (#30) greater than or equal to the total WQv required (#28)? NONE PROVIDED 32a. Is the Total RRv provided (#30) greater than or equal to the Minimum RRv Required (#32)? NONE PROVIDED 2/24/26, 3:37 PM NYSDEC eBusiness Portal System - NOI for coverage under Stormwater General Permit for Construction Activity. Revision 1 https://nform-prod.dec.ny.gov/app/#/submissionwizard/d2faca91-9caa-46ea-b0f5-6891f386c548/10 11/19 Note: Use the space provided in question #39 to summarize the specific site limitations and justification for not reducing 100% of WQv required (#28). A detailed evaluation of the specific site limitations and justification for not reducing 100% of the WQv required (#28) must also be included in the SWPPP. If No, sizing criteria has not been met; therefore, NOI can not be processed. SWPPP preparer must modify design to meet sizing criteria. 33. SMPs Use the Post-construction SMP Identification section to identify the Standard SMPs and, if applicable, the Alternative SMPs to be used to treat the remaining total WQv (=Total WQv Required in #28 - Total RRv Provided in #30). Also, provide the total impervious area that contributes runoff to each practice selected. NOTE: Use the Post-construction SMP Identification section to identify the SMPs used on Redevelopment projects. 33a. Indicate the Total WQv provided (i.e. WQv treated) by the SMPs identified in question #33 and Standard SMPs with RRv Capacity identified in question #29. (acre-feet) Note: For the standard SMPs with RRv capacity, the WQv provided by each practice = the WQv calculated using the contributing drainage area to the practice - provided by the practice. (See Table 3.5 in Design Manual) 34. Provide the sum of the Total RRv provided (#30) and the WQv provided (#33a). If Yes, go to question 36. If No, sizing criteria has not been met; therefore, NOI can not be processed. SWPPP preparer must modify design to meet sizing criteria. NONE PROVIDED NONE PROVIDED 35. Is the sum of the RRv provided (#30) and the WQv provided (#33a) greater than or equal to the total WQv required (#28)? NONE PROVIDED 2/24/26, 3:37 PM NYSDEC eBusiness Portal System - NOI for coverage under Stormwater General Permit for Construction Activity. Revision 1 https://nform-prod.dec.ny.gov/app/#/submissionwizard/d2faca91-9caa-46ea-b0f5-6891f386c548/10 12/19 36. Provide the total Channel Protection Storage Volume (CPv required and provided or select waiver (#36a), if applicable. CPv Required (acre-feet) CPv Provided (acre-feet) Reduction of the total CPv is achieved on site through runoff reduction techniques or infiltration systems. 37. Provide the Overbank Flood (Qp) and Extreme Flood (Qf) control criteria or select waiver (#37a), if applicable. Overbank Flood Control Criteria (Qp) Pre-Development (CFS) 1.53 Post-Development (CFS) 0.91 Total Extreme Flood Control Criteria (Qf) Pre-Development (CFS) 2.61 Post-Development (CFS) 1.23 Yes If Yes, Identify the entity responsible for the long term Operation and Maintenance JH Hemmingway HOA NONE PROVIDED NONE PROVIDED 36a. The need to provide channel protection has been waived because: 37a. The need to meet the Qp and Qf criteria has been waived because: NONE PROVIDED 38. Has a long term Operation and Maintenance Plan for the post-construction stormwater management practice(s) been developed? 2/24/26, 3:37 PM NYSDEC eBusiness Portal System - NOI for coverage under Stormwater General Permit for Construction Activity. Revision 1 https://nform-prod.dec.ny.gov/app/#/submissionwizard/d2faca91-9caa-46ea-b0f5-6891f386c548/10 13/19 39. Use this space to summarize the specific site limitations and justification for not reducing 100% of WQv required (#28). (See question #32a) This space can also be used for other pertinent project information. Post-Construction SMP Identification Runoff Reduction (RR) Techniques, Standard Stormwater Management Practices (SMPs) and Alternative SMPs Identify the Post-construction SMPs to be used by providing the total impervious area that contributes runoff to each technique/practice selected. For the Area Reduction Techniques, provide the total contributing area (includes pervious area) and, if applicable, the total impervious area that contributes runoff to the technique/practice. RR Techniques (Area Reduction) Round to the nearest tenth Total Contributing Acres for Conservation of Natural Area (RR-1) Total Contributing Impervious Acres for Conservation of Natural Area (RR-1) Total Contributing Acres for Sheetflow to Riparian Buffers/Filter Strips (RR-2) Total Contributing Impervious Acres for Sheetflow to Riparian Buffers/Filter Strips (RR-2) Total Contributing Acres for Tree Planting/Tree Pit (RR-3) Total Contributing Impervious Acres for Tree Planting/Tree Pit (RR-3) NONE PROVIDED NONE PROVIDED NONE PROVIDED NONE PROVIDED NONE PROVIDED NONE PROVIDED NONE PROVIDED 2/24/26, 3:37 PM NYSDEC eBusiness Portal System - NOI for coverage under Stormwater General Permit for Construction Activity. Revision 1 https://nform-prod.dec.ny.gov/app/#/submissionwizard/d2faca91-9caa-46ea-b0f5-6891f386c548/10 14/19 Total Contributing Acres for Disconnection of Rooftop Runoff (RR-4) RR Techniques (Volume Reduction) Total Contributing Impervious Acres for Disconnection of Rooftop Runoff (RR-4) Total Contributing Impervious Acres for Vegetated Swale (RR-5) Total Contributing Impervious Acres for Rain Garden (RR-6) Total Contributing Impervious Acres for Stormwater Planter (RR-7) Total Contributing Impervious Acres for Rain Barrel/Cistern (RR-8) Total Contributing Impervious Acres for Porous Pavement (RR-9) .5 Total Contributing Impervious Acres for Green Roof (RR-10) Standard SMPs with RRv Capacity Total Contributing Impervious Acres for Infiltration Trench (I-1) Total Contributing Impervious Acres for Infiltration Basin (I-2) Total Contributing Impervious Acres for Dry Well (I-3) .3 NONE PROVIDED NONE PROVIDED NONE PROVIDED NONE PROVIDED NONE PROVIDED NONE PROVIDED NONE PROVIDED NONE PROVIDED NONE PROVIDED 2/24/26, 3:37 PM NYSDEC eBusiness Portal System - NOI for coverage under Stormwater General Permit for Construction Activity. Revision 1 https://nform-prod.dec.ny.gov/app/#/submissionwizard/d2faca91-9caa-46ea-b0f5-6891f386c548/10 15/19 Total Contributing Impervious Acres for Underground Infiltration System (I-4) .5 Total Contributing Impervious Acres for Bioretention (F-5) Total Contributing Impervious Acres for Dry Swale (O-1) Standard SMPs Total Contributing Impervious Acres for Micropool Extended Detention (P-1) Total Contributing Impervious Acres for Wet Pond (P-2) Total Contributing Impervious Acres for Wet Extended Detention (P-3) Total Contributing Impervious Acres for Multiple Pond System (P-4) Total Contributing Impervious Acres for Pocket Pond (P-5) Total Contributing Impervious Acres for Surface Sand Filter (F-1) Total Contributing Impervious Acres for Underground Sand Filter (F-2) Total Contributing Impervious Acres for Perimeter Sand Filter (F-3) Total Contributing Impervious Acres for Organic Filter (F-4) NONE PROVIDED NONE PROVIDED NONE PROVIDED NONE PROVIDED NONE PROVIDED NONE PROVIDED NONE PROVIDED NONE PROVIDED NONE PROVIDED NONE PROVIDED NONE PROVIDED 2/24/26, 3:37 PM NYSDEC eBusiness Portal System - NOI for coverage under Stormwater General Permit for Construction Activity. Revision 1 https://nform-prod.dec.ny.gov/app/#/submissionwizard/d2faca91-9caa-46ea-b0f5-6891f386c548/10 16/19 Total Contributing Impervious Acres for Shallow Wetland (W-1) Total Contributing Impervious Acres for Extended Detention Wetland (W-2) Total Contributing Impervious Acres for Pond/Wetland System (W-3) Total Contributing Impervious Acres for Pocket Wetland (W-4) Total Contributing Impervious Acres for Wet Swale (O-2) Alternative SMPs (DO NOT INCLUDE PRACTICES BEING USED FOR PRETREATMENT ONLY) Total Contributing Impervious Area for Hydrodynamic Total Contributing Impervious Area for Wet Vault Total Contributing Impervious Area for Media Filter "Other" Alternative SMP? Total Contributing Impervious Area for "Other" Provide the name and manufaturer of the alternative SMPs (i.e. proprietary practice(s)) being used for WQv treatment. Note: Redevelopment projects which do not use RR techniques, shall use questions 28, 29, 33 and 33a to provide SMPs used, total WQv required and total WQv provided for the project. NONE PROVIDED NONE PROVIDED NONE PROVIDED NONE PROVIDED NONE PROVIDED NONE PROVIDED NONE PROVIDED NONE PROVIDED NONE PROVIDED NONE PROVIDED 2/24/26, 3:37 PM NYSDEC eBusiness Portal System - NOI for coverage under Stormwater General Permit for Construction Activity. Revision 1 https://nform-prod.dec.ny.gov/app/#/submissionwizard/d2faca91-9caa-46ea-b0f5-6891f386c548/10 17/19 Manufacturer of Alternative SMP Name of Alternative SMP Other Permits None If SPDES Multi-Sector GP, then give permit ID If Other, then identify No If "Yes," then indicate Size of Impact, in acres, to the nearest tenth 42. If this NOI is being submitted for the purpose of continuing or transferring coverage under a general permit for stormwater runoff from construction activities, please indicate the former SPDES number assigned. MS4 SWPPP Acceptance Yes - Please attach the MS4 Acceptance form below If No, skip question 44 NONE PROVIDED NONE PROVIDED 40. Identify other DEC permits, existing and new, that are required for this project/facility. NONE PROVIDED NONE PROVIDED 41. Does this project require a US Army Corps of Engineers Wetland Permit? NONE PROVIDED NONE PROVIDED 43. Is this project subject to the requirements of a regulated, traditional land use control MS4? 2/24/26, 3:37 PM NYSDEC eBusiness Portal System - NOI for coverage under Stormwater General Permit for Construction Activity. Revision 1 https://nform-prod.dec.ny.gov/app/#/submissionwizard/d2faca91-9caa-46ea-b0f5-6891f386c548/10 18/19 Yes MS4 SWPPP Acceptance Form Download Download form from the link below. Complete, sign, and upload. MS4 SWPPP Acceptance Form MS4 Acceptance Form Upload Comment Owner/Operator Certification Owner/Operator Certification Form Download Download the certification form by clicking the link below. Complete, sign, scan, and upload the form. Owner/Operator Certification Form (PDF, 45KB) Upload Owner/Operator Certification Form Comment 44. Has the "MS4 SWPPP Acceptance" form been signed by the principal executive officer or ranking elected official and submitted along with this NOI? NONE PROVIDED NONE PROVIDED NONE PROVIDED NONE PROVIDED 2/24/26, 3:37 PM NYSDEC eBusiness Portal System - NOI for coverage under Stormwater General Permit for Construction Activity. Revision 1 https://nform-prod.dec.ny.gov/app/#/submissionwizard/d2faca91-9caa-46ea-b0f5-6891f386c548/10 19/19 Appendix B Existing Conditions Watershed Map and HydroCAD Calculations 1 2 3 4 5 AP-2 AP-1 JW Hemmingway PUD 110-114 Nelson Avenue, Saratoga Springs, NY 12866 Pre-Development Date: 2/13/2026 LEGEND SUBCATCHMENT BOUNDARY TIME OF CONCENTRATION PATH ANALYSIS POINT SUBCATCHMENT ID AP-1 1 10 5 10 15 20200 Scale: 1" = 20' 1 Subcat 1 2 Subcat 2 3 Subcat 3 4 Subcat 4 5 Subcat 5 6L LP-2 AP-1 AP-1 AP-2 AP-2 Routing Diagram for Pre-Development Witt Nelson Prepared by The LA Group, PC, Printed 2/13/2026 HydroCAD® 10.20-4c s/n 00439 © 2024 HydroCAD Software Solutions LLC Subcat Reach Pond Link Pre-Development Witt Nelson Printed 2/13/2026Prepared by The LA Group, PC Page 2HydroCAD® 10.20-4c s/n 00439 © 2024 HydroCAD Software Solutions LLC Area Listing (all nodes) Area (sq-ft) CN Description (subcatchment-numbers) 85,782 39 >75% Grass cover, Good, HSG A (1, 2, 3, 4, 5) 28,053 98 Paved parking, HSG A (1, 2, 3, 4, 5) 113,835 54 TOTAL AREA Pre-Development Witt Nelson Printed 2/13/2026Prepared by The LA Group, PC Page 3HydroCAD® 10.20-4c s/n 00439 © 2024 HydroCAD Software Solutions LLC Soil Listing (all nodes) Area (sq-ft) Soil Group Subcatchment Numbers 113,835 HSG A 1, 2, 3, 4, 5 0 HSG B 0 HSG C 0 HSG D 0 Other 113,835 TOTAL AREA Pre-Development Witt Nelson Printed 2/13/2026Prepared by The LA Group, PC Page 4HydroCAD® 10.20-4c s/n 00439 © 2024 HydroCAD Software Solutions LLC Ground Covers (all nodes) HSG-A (sq-ft) HSG-B (sq-ft) HSG-C (sq-ft) HSG-D (sq-ft) Other (sq-ft) Total (sq-ft) Ground Cover Sub Num 85,782 000085,782 >75% Grass cover, Good 28,053 000028,053 Paved parking 113,835 0000113,835 TOTAL AREA NY-Nelson 24-hr S1 1-yr Rainfall=2.24"Pre-Development Witt Nelson Printed 2/13/2026Prepared by The LA Group, PC Page 5HydroCAD® 10.20-4c s/n 00439 © 2024 HydroCAD Software Solutions LLC Time span=0.00-24.00 hrs, dt=0.05 hrs, 481 points Runoff by SCS TR-20 method, UH=SCS, Weighted-Q Reach routing by Dyn-Stor-Ind method - Pond routing by Dyn-Stor-Ind method Runoff Area=40,115 sf 28.99% Impervious Runoff Depth>0.58"Subcatchment 1: Subcat 1 Flow Length=179' Tc=11.3 min CN=WQ Runoff=0.51 cfs 1,946 cf Runoff Area=9,048 sf 19.50% Impervious Runoff Depth>0.39"Subcatchment 2: Subcat 2 Tc=6.0 min CN=WQ Runoff=0.10 cfs 296 cf Runoff Area=44,244 sf 21.65% Impervious Runoff Depth>0.44"Subcatchment 3: Subcat 3 Tc=6.0 min CN=WQ Runoff=0.53 cfs 1,604 cf Runoff Area=14,589 sf 8.43% Impervious Runoff Depth>0.17"Subcatchment 4: Subcat 4 Flow Length=95' Tc=9.0 min CN=WQ Runoff=0.06 cfs 206 cf Runoff Area=5,839 sf 65.97% Impervious Runoff Depth>1.33"Subcatchment 5: Subcat 5 Tc=6.0 min CN=WQ Runoff=0.21 cfs 645 cf Inflow=0.53 cfs 1,604 cfLink 6L: LP-2 Primary=0.53 cfs 1,604 cf Inflow=0.57 cfs 2,152 cfLink AP-1: AP-1 Primary=0.57 cfs 2,152 cf Inflow=0.31 cfs 941 cfLink AP-2: AP-2 Primary=0.31 cfs 941 cf Total Runoff Area = 113,835 sf Runoff Volume = 4,698 cf Average Runoff Depth = 0.50" 75.36% Pervious = 85,782 sf 24.64% Impervious = 28,053 sf NY-Nelson 24-hr S1 10-yr Rainfall=3.74"Pre-Development Witt Nelson Printed 2/13/2026Prepared by The LA Group, PC Page 6HydroCAD® 10.20-4c s/n 00439 © 2024 HydroCAD Software Solutions LLC Time span=0.00-24.00 hrs, dt=0.05 hrs, 481 points Runoff by SCS TR-20 method, UH=SCS, Weighted-Q Reach routing by Dyn-Stor-Ind method - Pond routing by Dyn-Stor-Ind method Runoff Area=40,115 sf 28.99% Impervious Runoff Depth>1.03"Subcatchment 1: Subcat 1 Flow Length=179' Tc=11.3 min CN=WQ Runoff=0.90 cfs 3,445 cf Runoff Area=9,048 sf 19.50% Impervious Runoff Depth>0.70"Subcatchment 2: Subcat 2 Tc=6.0 min CN=WQ Runoff=0.17 cfs 529 cf Runoff Area=44,244 sf 21.65% Impervious Runoff Depth>0.78"Subcatchment 3: Subcat 3 Tc=6.0 min CN=WQ Runoff=0.91 cfs 2,861 cf Runoff Area=14,589 sf 8.43% Impervious Runoff Depth>0.32"Subcatchment 4: Subcat 4 Flow Length=95' Tc=9.0 min CN=WQ Runoff=0.10 cfs 384 cf Runoff Area=5,839 sf 65.97% Impervious Runoff Depth>2.32"Subcatchment 5: Subcat 5 Tc=6.0 min CN=WQ Runoff=0.36 cfs 1,128 cf Inflow=0.91 cfs 2,861 cfLink 6L: LP-2 Primary=0.91 cfs 2,861 cf Inflow=1.00 cfs 3,829 cfLink AP-1: AP-1 Primary=1.00 cfs 3,829 cf Inflow=0.53 cfs 1,657 cfLink AP-2: AP-2 Primary=0.53 cfs 1,657 cf Total Runoff Area = 113,835 sf Runoff Volume = 8,347 cf Average Runoff Depth = 0.88" 75.36% Pervious = 85,782 sf 24.64% Impervious = 28,053 sf NY-Nelson 24-hr S1 100-yr Rainfall=6.27"Pre-Development Witt Nelson Printed 2/13/2026Prepared by The LA Group, PC Page 1HydroCAD® 10.20-4c s/n 00439 © 2024 HydroCAD Software Solutions LLC Time span=0.00-24.00 hrs, dt=0.05 hrs, 481 points Runoff by SCS TR-20 method, UH=SCS, Weighted-Q Reach routing by Dyn-Stor-Ind method - Pond routing by Dyn-Stor-Ind method Runoff Area=40,115 sf 28.99% Impervious Runoff Depth>2.12"Subcatchment 1: Subcat 1 Flow Length=179' Tc=11.3 min CN=WQ Runoff=1.53 cfs 7,076 cf Runoff Area=9,048 sf 19.50% Impervious Runoff Depth>1.60"Subcatchment 2: Subcat 2 Tc=6.0 min CN=WQ Runoff=0.28 cfs 1,204 cf Runoff Area=44,244 sf 21.65% Impervious Runoff Depth>1.72"Subcatchment 3: Subcat 3 Tc=6.0 min CN=WQ Runoff=1.53 cfs 6,324 cf Runoff Area=14,589 sf 8.43% Impervious Runoff Depth>0.99"Subcatchment 4: Subcat 4 Flow Length=95' Tc=9.0 min CN=WQ Runoff=0.19 cfs 1,200 cf Runoff Area=5,839 sf 65.97% Impervious Runoff Depth>4.15"Subcatchment 5: Subcat 5 Tc=6.0 min CN=WQ Runoff=0.60 cfs 2,021 cf Inflow=1.53 cfs 6,324 cfLink 6L: LP-2 Primary=1.53 cfs 6,324 cf Inflow=1.73 cfs 8,275 cfLink AP-1: AP-1 Primary=1.73 cfs 8,275 cf Inflow=0.88 cfs 3,225 cfLink AP-2: AP-2 Primary=0.88 cfs 3,225 cf Total Runoff Area = 113,835 sf Runoff Volume = 17,825 cf Average Runoff Depth = 1.88" 75.36% Pervious = 85,782 sf 24.64% Impervious = 28,053 sf NY-Nelson 24-hr S1 100-yr Rainfall=6.27"Pre-Development Witt Nelson Printed 2/13/2026Prepared by The LA Group, PC Page 2HydroCAD® 10.20-4c s/n 00439 © 2024 HydroCAD Software Solutions LLC Summary for Subcatchment 1: Subcat 1 Runoff = 1.53 cfs @ 12.11 hrs, Volume= 7,076 cf, Depth> 2.12" Routed to Link AP-1 : AP-1 Runoff by SCS TR-20 method, UH=SCS, Weighted-Q, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs NY-Nelson 24-hr S1 100-yr Rainfall=6.27" Area (sf) CN Description 28,484 39 >75% Grass cover, Good, HSG A 11,631 98 Paved parking, HSG A 40,115 Weighted Average 28,484 71.01% Pervious Area 11,631 28.99% Impervious Area Tc Length Slope Velocity Capacity Description (min) (feet) (ft/ft) (ft/sec) (cfs) 10.8 86 0.0150 0.13 Sheet Flow, Grass: Short n= 0.150 P2= 2.61" 0.5 93 0.0200 2.87 Shallow Concentrated Flow, Paved Kv= 20.3 fps 11.3 179 Total Summary for Subcatchment 2: Subcat 2 Runoff = 0.28 cfs @ 12.05 hrs, Volume= 1,204 cf, Depth> 1.60" Routed to Link AP-2 : AP-2 Runoff by SCS TR-20 method, UH=SCS, Weighted-Q, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs NY-Nelson 24-hr S1 100-yr Rainfall=6.27" Area (sf) CN Description 7,284 39 >75% Grass cover, Good, HSG A 1,764 98 Paved parking, HSG A 9,048 Weighted Average 7,284 80.50% Pervious Area 1,764 19.50% Impervious Area Tc Length Slope Velocity Capacity Description (min) (feet) (ft/ft) (ft/sec) (cfs) 6.0 Direct Entry, Summary for Subcatchment 3: Subcat 3 Runoff = 1.53 cfs @ 12.04 hrs, Volume= 6,324 cf, Depth> 1.72" Routed to Link 6L : LP-2 Runoff by SCS TR-20 method, UH=SCS, Weighted-Q, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs NY-Nelson 24-hr S1 100-yr Rainfall=6.27" NY-Nelson 24-hr S1 100-yr Rainfall=6.27"Pre-Development Witt Nelson Printed 2/13/2026Prepared by The LA Group, PC Page 3HydroCAD® 10.20-4c s/n 00439 © 2024 HydroCAD Software Solutions LLC Area (sf) CN Description 34,667 39 >75% Grass cover, Good, HSG A 9,577 98 Paved parking, HSG A 44,244 Weighted Average 34,667 78.35% Pervious Area 9,577 21.65% Impervious Area Tc Length Slope Velocity Capacity Description (min) (feet) (ft/ft) (ft/sec) (cfs) 6.0 Direct Entry, Summary for Subcatchment 4: Subcat 4 Runoff = 0.19 cfs @ 12.10 hrs, Volume= 1,200 cf, Depth> 0.99" Routed to Link AP-1 : AP-1 Runoff by SCS TR-20 method, UH=SCS, Weighted-Q, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs NY-Nelson 24-hr S1 100-yr Rainfall=6.27" Area (sf) CN Description 13,360 39 >75% Grass cover, Good, HSG A 1,230 98 Paved parking, HSG A 14,589 Weighted Average 13,360 91.57% Pervious Area 1,230 8.43% Impervious Area Tc Length Slope Velocity Capacity Description (min) (feet) (ft/ft) (ft/sec) (cfs) 2.2 17 0.0300 0.13 Sheet Flow, Grass: Short n= 0.150 P2= 2.61" 0.2 13 0.0300 0.97 Sheet Flow, Smooth surfaces n= 0.011 P2= 2.61" 6.2 50 0.0200 0.13 Sheet Flow, Grass: Short n= 0.150 P2= 2.61" 0.4 15 0.0100 0.70 Shallow Concentrated Flow, Short Grass Pasture Kv= 7.0 fps 9.0 95 Total Summary for Subcatchment 5: Subcat 5 Runoff = 0.60 cfs @ 12.04 hrs, Volume= 2,021 cf, Depth> 4.15" Routed to Link AP-2 : AP-2 Runoff by SCS TR-20 method, UH=SCS, Weighted-Q, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs NY-Nelson 24-hr S1 100-yr Rainfall=6.27" NY-Nelson 24-hr S1 100-yr Rainfall=6.27"Pre-Development Witt Nelson Printed 2/13/2026Prepared by The LA Group, PC Page 4HydroCAD® 10.20-4c s/n 00439 © 2024 HydroCAD Software Solutions LLC Area (sf) CN Description 1,987 39 >75% Grass cover, Good, HSG A 3,852 98 Paved parking, HSG A 5,839 Weighted Average 1,987 34.03% Pervious Area 3,852 65.97% Impervious Area Tc Length Slope Velocity Capacity Description (min) (feet) (ft/ft) (ft/sec) (cfs) 6.0 Direct Entry, Summary for Link 6L: LP-2 Inflow Area = 44,244 sf, 21.65% Impervious, Inflow Depth > 1.72" for 100-yr event Inflow = 1.53 cfs @ 12.04 hrs, Volume= 6,324 cf Primary = 1.53 cfs @ 12.04 hrs, Volume= 6,324 cf, Atten= 0%, Lag= 0.0 min Primary outflow = Inflow, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs Summary for Link AP-1: AP-1 Inflow Area = 54,704 sf, 23.51% Impervious, Inflow Depth > 1.82" for 100-yr event Inflow = 1.73 cfs @ 12.11 hrs, Volume= 8,275 cf Primary = 1.73 cfs @ 12.11 hrs, Volume= 8,275 cf, Atten= 0%, Lag= 0.0 min Primary outflow = Inflow, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs Summary for Link AP-2: AP-2 Inflow Area = 14,887 sf, 37.72% Impervious, Inflow Depth > 2.60" for 100-yr event Inflow = 0.88 cfs @ 12.04 hrs, Volume= 3,225 cf Primary = 0.88 cfs @ 12.04 hrs, Volume= 3,225 cf, Atten= 0%, Lag= 0.0 min Primary outflow = Inflow, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs Appendix C Proposed Condition Watershed Map and HydroCAD Calculations 31 1 311 311 3 1 1 311 311 31 1 3 1 1 311 3 1 1 310 311 311 31 0 3 1 1 311 31 1 311 31 1 3 1 1 311 311 HEMINGWAY M U S E R D 1 2 4 5 6 7 89 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 12a 8a 19a 8b 8c7a 7b 7c 6a 4a 4B 13a 13b 13c 13d 13e 12b 12c 10a 10b 10c 11a 9a 9b 9c9e AP-2 AP-1 1 SMP 2 SMP 3B SMP 3A SMP 3D SMP 3C SMP 13g 13f 19b 4B SMP 4C SMP 4A SMP JW HEMINGWAY PUD Nelson Avenue, Saratoga Springs, NY 12866 Post-Development Date: 2/13/2026 LEGEND SUBCATCHMENT BOUNDARY TIME OF CONCENTRATION PATH ANALYSIS POINT SUBCATCHMENT ID AP-1 1 10 5 10 15 20200 Scale: 1" = 20' STORMWATER MANAGEMENT PRACTICE 1 SMP POROUS PAVERS 1 Subcat 1 2 Subcat 2 4 Subcat 4 4a Subcat 4a 4b Subcat 4b 5 Subcat 5 6 Subcat 6 6a Subcat 6a 7 Subcat 7 7a Subcat 7a 7b Subcat 7b 7c Subcat 7c 8 Subcat 8 8a Subcat 8a 8b Subcat 8b 8c Subcat 8c 9 Subcat 9 9a Subcat 9a 9b Subcat 9b 9c Subcat 9c 9e Subcat 9e 10 Subcat 10 10a Subcat 10a 10b Subcat 10b 10c Subcat 10c 11 Subcat 11 11a Subcat 11a 12 Subcat 12 12a Subcat 12a 12b Subcat 12b 12c Subcat 12c 13 Subcat 13 13a Subcat 13a 13b Subcat 13b 13c Subcat 13c 13d Subcat 13d 13e Subcat 13e 13f Subcat 13f 13g Subcat 13g 14 Subcat 14 15 Subcat 15 16 Subcat 16 17 Subcat 17 18 Subcat 18 19 Subcat 19 19a Subcat 19a 19b Subcat 19b 20 Subcat 20 21 Subcat 21 22 Subcat 22 23 Subcat 23 24 Subcat 24 25 Subcat 25 26 Subcat 26 27 Subcat 27 28 Subcat 28 1PCB YD-19 3PCB YD-13 4PCB YD-4 6PCB YD-15 9PCB YD-3 12PCB YD-8 17PCB Perf Header Pipe 18PCB CB-1 21PCB YD-20 23PCB Perf Header Pipe 24PCB YD-6 26PCB YD-11 27PCB YD-10 29PCB MH-1 31PCB YD-16 33PCB YD-18 34PCB YD-21 35PCB YD-22 SMP-1 Chambers SMP-2 Porous Pavers SMP-2A Porous Pavers SMP-3A Drywell SMP-3B Drywell SMP-3C Drywell SMP-3D Drywell SMP-4A Porous Pavement SMP-4B Porous Pavement SMP-4C Porous Pavement AP-1 AP-1 AP-2 AP-2 Routing Diagram for Post-Development Witt Nelson Prepared by The LA Group, PC, Printed 2/25/2026 HydroCAD® 10.20-4c s/n 00439 © 2024 HydroCAD Software Solutions LLC Subcat Reach Pond Link Post-Development Witt Nelson Printed 2/25/2026Prepared by The LA Group, PC Page 2HydroCAD® 10.20-4c s/n 00439 © 2024 HydroCAD Software Solutions LLC Area Listing (all nodes) Area (sq-ft) CN Description (subcatchment-numbers) 46,442 39 >75% Grass cover, Good, HSG A (1, 2, 4, 6a, 7, 7a, 7c, 8, 8a, 8b, 8c, 9, 9c, 9e, 10, 10a, 11, 11a, 12a, 12b, 13d, 13f, 13g, 14, 15, 16, 17, 18, 19, 19a, 19b, 20, 21, 22, 23, 24, 25, 26, 27, 28) 67,460 98 Paved parking, HSG A (1, 2, 4, 4a, 4b, 5, 6, 6a, 7, 7a, 7b, 7c, 8, 8a, 8b, 8c, 9, 9a, 9b, 9c, 9e, 10, 10a, 10b, 10c, 11, 11a, 12, 12a, 12b, 12c, 13, 13a, 13b, 13c, 13d, 13e, 13f, 13g, 14, 15, 16, 17, 18, 19, 19a, 19b, 20, 21, 22, 23, 24, 25, 26, 27, 28) 113,902 74 TOTAL AREA Post-Development Witt Nelson Printed 2/25/2026Prepared by The LA Group, PC Page 3HydroCAD® 10.20-4c s/n 00439 © 2024 HydroCAD Software Solutions LLC Soil Listing (all nodes) Area (sq-ft) Soil Group Subcatchment Numbers 113,902 HSG A 1, 2, 4, 4a, 4b, 5, 6, 6a, 7, 7a, 7b, 7c, 8, 8a, 8b, 8c, 9, 9a, 9b, 9c, 9e, 10, 10a, 10b, 10c, 11, 11a, 12, 12a, 12b, 12c, 13, 13a, 13b, 13c, 13d, 13e, 13f, 13g, 14, 15, 16, 17, 18, 19, 19a, 19b, 20, 21, 22, 23, 24, 25, 26, 27, 28 0 HSG B 0 HSG C 0 HSG D 0 Other 113,902 TOTAL AREA Post-Development Witt Nelson Printed 2/25/2026Prepared by The LA Group, PC Page 4HydroCAD® 10.20-4c s/n 00439 © 2024 HydroCAD Software Solutions LLC Ground Covers (all nodes) HSG-A (sq-ft) HSG-B (sq-ft) HSG-C (sq-ft) HSG-D (sq-ft) Other (sq-ft) Total (sq-ft) Ground Cover Sub Num 46,442 000046,442 >75% Grass cover, Good 67,460 000067,460 Paved parking 113,902 0000113,902 TOTAL AREA NY-Nelson 24-hr S1 1-yr Rainfall=2.24"Post-Development Witt Nelson Printed 2/25/2026Prepared by The LA Group, PC Page 5HydroCAD® 10.20-4c s/n 00439 © 2024 HydroCAD Software Solutions LLC Time span=0.00-24.00 hrs, dt=0.05 hrs, 481 points Runoff by SCS TR-20 method, UH=SCS, Weighted-Q Reach routing by Dyn-Stor-Ind method - Pond routing by Dyn-Stor-Ind method Runoff Area=24,700 sf 26.81% Impervious Runoff Depth>0.54"Subcatchment 1: Subcat 1 Flow Length=91' Tc=10.8 min CN=WQ Runoff=0.30 cfs 1,108 cf Runoff Area=5,682 sf 72.48% Impervious Runoff Depth>1.46"Subcatchment 2: Subcat 2 Tc=6.0 min CN=WQ Runoff=0.23 cfs 690 cf Runoff Area=2,224 sf 99.73% Impervious Runoff Depth>2.00"Subcatchment 4: Subcat 4 Tc=6.0 min CN=WQ Runoff=0.12 cfs 372 cf Runoff Area=863 sf 100.00% Impervious Runoff Depth>2.01"Subcatchment 4a: Subcat 4a Tc=6.0 min CN=98 Runoff=0.05 cfs 145 cf Runoff Area=377 sf 100.00% Impervious Runoff Depth>2.01"Subcatchment 4b: Subcat 4b Tc=6.0 min CN=98 Runoff=0.02 cfs 63 cf Runoff Area=450 sf 100.00% Impervious Runoff Depth>2.01"Subcatchment 5: Subcat 5 Tc=6.0 min CN=98 Runoff=0.02 cfs 75 cf Runoff Area=375 sf 100.00% Impervious Runoff Depth>2.01"Subcatchment 6: Subcat 6 Tc=6.0 min CN=98 Runoff=0.02 cfs 63 cf Runoff Area=404 sf 99.91% Impervious Runoff Depth>2.01"Subcatchment 6a: Subcat 6a Tc=6.0 min CN=WQ Runoff=0.02 cfs 68 cf Runoff Area=974 sf 100.00% Impervious Runoff Depth>2.01"Subcatchment 7: Subcat 7 Tc=6.0 min CN=WQ Runoff=0.05 cfs 163 cf Runoff Area=431 sf 99.99% Impervious Runoff Depth>2.01"Subcatchment 7a: Subcat 7a Tc=6.0 min CN=WQ Runoff=0.02 cfs 72 cf Runoff Area=405 sf 100.00% Impervious Runoff Depth>2.01"Subcatchment 7b: Subcat 7b Tc=6.0 min CN=98 Runoff=0.02 cfs 68 cf Runoff Area=295 sf 100.00% Impervious Runoff Depth>2.01"Subcatchment 7c: Subcat 7c Tc=6.0 min CN=WQ Runoff=0.02 cfs 49 cf Runoff Area=1,004 sf 52.61% Impervious Runoff Depth>1.06"Subcatchment 8: Subcat 8 Tc=6.0 min CN=WQ Runoff=0.03 cfs 88 cf Runoff Area=1,884 sf 59.38% Impervious Runoff Depth>1.19"Subcatchment 8a: Subcat 8a Tc=6.0 min CN=WQ Runoff=0.06 cfs 187 cf Runoff Area=639 sf 99.98% Impervious Runoff Depth>2.01"Subcatchment 8b: Subcat 8b Tc=6.0 min CN=WQ Runoff=0.04 cfs 107 cf Runoff Area=1,712 sf 99.93% Impervious Runoff Depth>2.01"Subcatchment 8c: Subcat 8c Tc=6.0 min CN=WQ Runoff=0.09 cfs 287 cf NY-Nelson 24-hr S1 1-yr Rainfall=2.24"Post-Development Witt Nelson Printed 2/25/2026Prepared by The LA Group, PC Page 6HydroCAD® 10.20-4c s/n 00439 © 2024 HydroCAD Software Solutions LLC Runoff Area=1,248 sf 99.86% Impervious Runoff Depth>2.01"Subcatchment 9: Subcat 9 Tc=6.0 min CN=WQ Runoff=0.07 cfs 209 cf Runoff Area=599 sf 100.00% Impervious Runoff Depth>2.01"Subcatchment 9a: Subcat 9a Tc=6.0 min CN=98 Runoff=0.03 cfs 100 cf Runoff Area=348 sf 100.00% Impervious Runoff Depth>2.01"Subcatchment 9b: Subcat 9b Tc=6.0 min CN=98 Runoff=0.02 cfs 58 cf Runoff Area=323 sf 99.85% Impervious Runoff Depth>2.01"Subcatchment 9c: Subcat 9c Tc=6.0 min CN=WQ Runoff=0.02 cfs 54 cf Runoff Area=554 sf 99.78% Impervious Runoff Depth>2.01"Subcatchment 9e: Subcat 9e Tc=6.0 min CN=WQ Runoff=0.03 cfs 93 cf Runoff Area=890 sf 99.91% Impervious Runoff Depth>2.01"Subcatchment 10: Subcat 10 Tc=6.0 min CN=WQ Runoff=0.05 cfs 149 cf Runoff Area=517 sf 100.00% Impervious Runoff Depth>2.01"Subcatchment 10a: Subcat 10a Tc=6.0 min CN=WQ Runoff=0.03 cfs 87 cf Runoff Area=660 sf 100.00% Impervious Runoff Depth>2.01"Subcatchment 10b: Subcat 10b Tc=6.0 min CN=98 Runoff=0.04 cfs 111 cf Runoff Area=433 sf 100.00% Impervious Runoff Depth>2.01"Subcatchment 10c: Subcat 10c Tc=6.0 min CN=98 Runoff=0.02 cfs 73 cf Runoff Area=3,594 sf 98.17% Impervious Runoff Depth>1.97"Subcatchment 11: Subcat 11 Tc=6.0 min CN=WQ Runoff=0.19 cfs 591 cf Runoff Area=431 sf 99.94% Impervious Runoff Depth>2.01"Subcatchment 11a: Subcat 11a Tc=6.0 min CN=WQ Runoff=0.02 cfs 72 cf Runoff Area=567 sf 100.00% Impervious Runoff Depth>2.01"Subcatchment 12: Subcat 12 Tc=6.0 min CN=98 Runoff=0.03 cfs 95 cf Runoff Area=1,169 sf 99.99% Impervious Runoff Depth>2.01"Subcatchment 12a: Subcat 12a Tc=6.0 min CN=WQ Runoff=0.06 cfs 196 cf Runoff Area=680 sf 100.00% Impervious Runoff Depth>2.01"Subcatchment 12b: Subcat 12b Tc=6.0 min CN=WQ Runoff=0.04 cfs 114 cf Runoff Area=617 sf 100.00% Impervious Runoff Depth>2.01"Subcatchment 12c: Subcat 12c Tc=6.0 min CN=98 Runoff=0.03 cfs 103 cf Runoff Area=1,658 sf 100.00% Impervious Runoff Depth>2.01"Subcatchment 13: Subcat 13 Tc=6.0 min CN=98 Runoff=0.09 cfs 278 cf Runoff Area=736 sf 100.00% Impervious Runoff Depth>2.01"Subcatchment 13a: Subcat 13a Tc=6.0 min CN=98 Runoff=0.04 cfs 123 cf Runoff Area=622 sf 100.00% Impervious Runoff Depth>2.01"Subcatchment 13b: Subcat 13b Tc=6.0 min CN=98 Runoff=0.03 cfs 104 cf NY-Nelson 24-hr S1 1-yr Rainfall=2.24"Post-Development Witt Nelson Printed 2/25/2026Prepared by The LA Group, PC Page 7HydroCAD® 10.20-4c s/n 00439 © 2024 HydroCAD Software Solutions LLC Runoff Area=482 sf 100.00% Impervious Runoff Depth>2.01"Subcatchment 13c: Subcat 13c Tc=6.0 min CN=98 Runoff=0.03 cfs 81 cf Runoff Area=930 sf 99.91% Impervious Runoff Depth>2.01"Subcatchment 13d: Subcat 13d Tc=6.0 min CN=WQ Runoff=0.05 cfs 156 cf Runoff Area=1,004 sf 100.00% Impervious Runoff Depth>2.01"Subcatchment 13e: Subcat 13e Tc=6.0 min CN=98 Runoff=0.06 cfs 168 cf Runoff Area=1,218 sf 61.44% Impervious Runoff Depth>1.24"Subcatchment 13f: Subcat 13f Tc=6.0 min CN=WQ Runoff=0.04 cfs 125 cf Runoff Area=559 sf 75.15% Impervious Runoff Depth>1.51"Subcatchment 13g: Subcat 13g Tc=6.0 min CN=WQ Runoff=0.02 cfs 70 cf Runoff Area=5,077 sf 2.63% Impervious Runoff Depth>0.05"Subcatchment 14: Subcat 14 Tc=6.0 min CN=WQ Runoff=0.01 cfs 22 cf Runoff Area=2,714 sf 29.86% Impervious Runoff Depth>0.60"Subcatchment 15: Subcat 15 Tc=6.0 min CN=WQ Runoff=0.04 cfs 136 cf Runoff Area=2,068 sf 96.33% Impervious Runoff Depth>1.94"Subcatchment 16: Subcat 16 Tc=6.0 min CN=WQ Runoff=0.11 cfs 334 cf Runoff Area=1,626 sf 59.86% Impervious Runoff Depth>1.20"Subcatchment 17: Subcat 17 Tc=6.0 min CN=WQ Runoff=0.05 cfs 163 cf Runoff Area=4,406 sf 17.21% Impervious Runoff Depth>0.35"Subcatchment 18: Subcat 18 Tc=6.0 min CN=WQ Runoff=0.04 cfs 127 cf Runoff Area=3,307 sf 53.26% Impervious Runoff Depth>1.07"Subcatchment 19: Subcat 19 Tc=6.0 min CN=WQ Runoff=0.10 cfs 295 cf Runoff Area=919 sf 22.72% Impervious Runoff Depth>0.46"Subcatchment 19a: Subcat 19a Tc=6.0 min CN=WQ Runoff=0.01 cfs 35 cf Runoff Area=2,686 sf 86.02% Impervious Runoff Depth>1.73"Subcatchment 19b: Subcat 19b Tc=6.0 min CN=WQ Runoff=0.13 cfs 387 cf Runoff Area=2,805 sf 44.57% Impervious Runoff Depth>0.90"Subcatchment 20: Subcat 20 Tc=6.0 min CN=WQ Runoff=0.07 cfs 209 cf Runoff Area=1,851 sf 45.30% Impervious Runoff Depth>0.91"Subcatchment 21: Subcat 21 Tc=6.0 min CN=WQ Runoff=0.05 cfs 140 cf Runoff Area=1,178 sf 52.92% Impervious Runoff Depth>1.06"Subcatchment 22: Subcat 22 Tc=6.0 min CN=WQ Runoff=0.03 cfs 104 cf Runoff Area=4,258 sf 43.94% Impervious Runoff Depth>0.88"Subcatchment 23: Subcat 23 Tc=6.0 min CN=WQ Runoff=0.10 cfs 313 cf NY-Nelson 24-hr S1 1-yr Rainfall=2.24"Post-Development Witt Nelson Printed 2/25/2026Prepared by The LA Group, PC Page 8HydroCAD® 10.20-4c s/n 00439 © 2024 HydroCAD Software Solutions LLC Runoff Area=10,599 sf 79.73% Impervious Runoff Depth>1.60"Subcatchment 24: Subcat 24 Tc=6.0 min CN=WQ Runoff=0.46 cfs 1,416 cf Runoff Area=2,802 sf 49.36% Impervious Runoff Depth>0.99"Subcatchment 25: Subcat 25 Tc=6.0 min CN=WQ Runoff=0.08 cfs 232 cf Runoff Area=1,134 sf 37.07% Impervious Runoff Depth>0.75"Subcatchment 26: Subcat 26 Tc=6.0 min CN=WQ Runoff=0.02 cfs 70 cf Runoff Area=2,319 sf 62.46% Impervious Runoff Depth>1.26"Subcatchment 27: Subcat 27 Tc=6.0 min CN=WQ Runoff=0.08 cfs 243 cf Runoff Area=1,895 sf 81.22% Impervious Runoff Depth>1.63"Subcatchment 28: Subcat 28 Tc=6.0 min CN=WQ Runoff=0.08 cfs 258 cf Peak Elev=308.18' Inflow=0.02 cfs 75 cfPond 1P: YD-19 8.0" Round Culvert n=0.012 L=20.0' S=0.0500 '/' Outflow=0.02 cfs 75 cf Peak Elev=308.64' Inflow=0.06 cfs 183 cfPond 3P: YD-13 8.0" Round Culvert n=0.012 L=75.0' S=0.0100 '/' Outflow=0.06 cfs 183 cf Peak Elev=308.13' Inflow=0.18 cfs 561 cfPond 4P: YD-4 8.0" Round Culvert n=0.012 L=44.0' S=0.0100 '/' Outflow=0.18 cfs 561 cf Peak Elev=308.31' Inflow=0.13 cfs 396 cfPond 6P: YD-15 8.0" Round Culvert n=0.012 L=20.0' S=0.0500 '/' Outflow=0.13 cfs 396 cf Peak Elev=307.78' Inflow=0.34 cfs 1,027 cfPond 9P: YD-3 8.0" Round Culvert n=0.012 L=34.0' S=0.0100 '/' Outflow=0.34 cfs 1,027 cf Peak Elev=307.63' Inflow=0.07 cfs 208 cfPond 12P: YD-8 8.0" Round Culvert n=0.012 L=80.0' S=0.0100 '/' Outflow=0.07 cfs 208 cf Peak Elev=308.65' Inflow=0.10 cfs 308 cfPond 17P: Perf Header Pipe 12.0" Round Culvert n=0.012 L=115.0' S=0.0100 '/' Outflow=0.10 cfs 308 cf Peak Elev=307.36' Inflow=0.33 cfs 998 cfPond 18P: CB-1 12.0" Round Culvert n=0.012 L=63.0' S=0.0100 '/' Outflow=0.33 cfs 998 cf Peak Elev=308.17' Inflow=0.10 cfs 295 cfPond 21P: YD-20 8.0" Round Culvert n=0.012 L=20.0' S=0.0500 '/' Outflow=0.10 cfs 295 cf Peak Elev=308.91' Inflow=0.09 cfs 276 cfPond 23P: Perf Header Pipe 8.0" Round Culvert n=0.012 L=82.0' S=0.0100 '/' Outflow=0.09 cfs 276 cf Peak Elev=307.08' Inflow=0.61 cfs 1,871 cfPond 24P: YD-6 12.0" Round Culvert n=0.012 L=40.0' S=0.0050 '/' Outflow=0.62 cfs 1,870 cf Peak Elev=308.02' Inflow=0.24 cfs 731 cfPond 26P: YD-11 8.0" Round Culvert n=0.012 L=42.0' S=0.0100 '/' Outflow=0.24 cfs 731 cf Peak Elev=307.09' Inflow=0.29 cfs 880 cfPond 27P: YD-10 12.0" Round Culvert n=0.012 L=47.0' S=0.0049 '/' Outflow=0.29 cfs 880 cf NY-Nelson 24-hr S1 1-yr Rainfall=2.24"Post-Development Witt Nelson Printed 2/25/2026Prepared by The LA Group, PC Page 9HydroCAD® 10.20-4c s/n 00439 © 2024 HydroCAD Software Solutions LLC Peak Elev=307.07' Inflow=1.28 cfs 3,895 cfPond 29P: MH-1 18.0" Round Culvert n=0.012 L=9.0' S=0.0344 '/' Outflow=1.28 cfs 3,895 cf Peak Elev=308.26' Inflow=0.21 cfs 628 cfPond 31P: YD-16 8.0" Round Culvert n=0.012 L=20.0' S=0.0500 '/' Outflow=0.21 cfs 628 cf Peak Elev=308.18' Inflow=0.03 cfs 93 cfPond 33P: YD-18 8.0" Round Culvert n=0.012 L=20.0' S=0.0500 '/' Outflow=0.03 cfs 93 cf Peak Elev=308.19' Inflow=0.12 cfs 372 cfPond 34P: YD-21 8.0" Round Culvert n=0.012 L=20.0' S=0.0500 '/' Outflow=0.12 cfs 372 cf Peak Elev=308.13' Inflow=0.05 cfs 145 cfPond 35P: YD-22 8.0" Round Culvert n=0.012 L=65.0' S=0.0077 '/' Outflow=0.05 cfs 145 cf Peak Elev=303.50' Storage=0 cf Inflow=1.28 cfs 3,895 cfPond SMP-1: Chambers Outflow=1.28 cfs 3,895 cf Peak Elev=308.00' Storage=0 cf Inflow=0.87 cfs 2,653 cfPond SMP-2: Porous Pavers Outflow=0.87 cfs 2,653 cf Peak Elev=0.00' Storage=0 cf Inflow=0.02 cfs 70 cfPond SMP-2A: Porous Pavers Outflow=0.02 cfs 70 cf Peak Elev=303.50' Storage=0 cf Inflow=0.13 cfs 390 cfPond SMP-3A: Drywell Outflow=0.13 cfs 390 cf Peak Elev=303.50' Storage=0 cf Inflow=0.08 cfs 230 cfPond SMP-3B: Drywell Outflow=0.08 cfs 230 cf Peak Elev=305.73' Storage=76 cf Inflow=0.27 cfs 830 cfPond SMP-3C: Drywell Discarded=0.11 cfs 830 cf Secondary=0.00 cfs 0 cf Outflow=0.11 cfs 830 cf Peak Elev=304.00' Storage=0 cf Inflow=0.11 cfs 330 cfPond SMP-3D: Drywell Outflow=0.11 cfs 330 cf Peak Elev=308.00' Storage=0 cf Inflow=0.04 cfs 125 cfPond SMP-4A: Porous Pavement Outflow=0.04 cfs 125 cf Peak Elev=308.50' Storage=0 cf Inflow=0.19 cfs 591 cfPond SMP-4B: Porous Pavement Outflow=0.19 cfs 591 cf Peak Elev=308.50' Storage=0 cf Inflow=0.13 cfs 387 cfPond SMP-4C: Porous Pavement Outflow=0.13 cfs 387 cf Inflow=0.30 cfs 1,108 cfLink AP-1: AP-1 Primary=0.30 cfs 1,108 cf Inflow=0.23 cfs 690 cfLink AP-2: AP-2 Primary=0.23 cfs 690 cf NY-Nelson 24-hr S1 1-yr Rainfall=2.24"Post-Development Witt Nelson Printed 2/25/2026Prepared by The LA Group, PC Page 10HydroCAD® 10.20-4c s/n 00439 © 2024 HydroCAD Software Solutions LLC Total Runoff Area = 113,902 sf Runoff Volume = 11,301 cf Average Runoff Depth = 1.19" 40.77% Pervious = 46,442 sf 59.23% Impervious = 67,460 sf NY-Nelson 24-hr S1 10-yr Rainfall=3.74"Post-Development Witt Nelson Printed 2/25/2026Prepared by The LA Group, PC Page 11HydroCAD® 10.20-4c s/n 00439 © 2024 HydroCAD Software Solutions LLC Time span=0.00-24.00 hrs, dt=0.05 hrs, 481 points Runoff by SCS TR-20 method, UH=SCS, Weighted-Q Reach routing by Dyn-Stor-Ind method - Pond routing by Dyn-Stor-Ind method Runoff Area=24,700 sf 26.81% Impervious Runoff Depth>0.95"Subcatchment 1: Subcat 1 Flow Length=91' Tc=10.8 min CN=WQ Runoff=0.52 cfs 1,965 cf Runoff Area=5,682 sf 72.48% Impervious Runoff Depth>2.55"Subcatchment 2: Subcat 2 Tc=6.0 min CN=WQ Runoff=0.39 cfs 1,205 cf Runoff Area=2,224 sf 99.73% Impervious Runoff Depth>3.49"Subcatchment 4: Subcat 4 Tc=6.0 min CN=WQ Runoff=0.21 cfs 647 cf Runoff Area=863 sf 100.00% Impervious Runoff Depth>3.50"Subcatchment 4a: Subcat 4a Tc=6.0 min CN=98 Runoff=0.08 cfs 252 cf Runoff Area=377 sf 100.00% Impervious Runoff Depth>3.50"Subcatchment 4b: Subcat 4b Tc=6.0 min CN=98 Runoff=0.04 cfs 110 cf Runoff Area=450 sf 100.00% Impervious Runoff Depth>3.50"Subcatchment 5: Subcat 5 Tc=6.0 min CN=98 Runoff=0.04 cfs 131 cf Runoff Area=375 sf 100.00% Impervious Runoff Depth>3.50"Subcatchment 6: Subcat 6 Tc=6.0 min CN=98 Runoff=0.04 cfs 109 cf Runoff Area=404 sf 99.91% Impervious Runoff Depth>3.50"Subcatchment 6a: Subcat 6a Tc=6.0 min CN=WQ Runoff=0.04 cfs 118 cf Runoff Area=974 sf 100.00% Impervious Runoff Depth>3.50"Subcatchment 7: Subcat 7 Tc=6.0 min CN=WQ Runoff=0.09 cfs 284 cf Runoff Area=431 sf 99.99% Impervious Runoff Depth>3.50"Subcatchment 7a: Subcat 7a Tc=6.0 min CN=WQ Runoff=0.04 cfs 126 cf Runoff Area=405 sf 100.00% Impervious Runoff Depth>3.50"Subcatchment 7b: Subcat 7b Tc=6.0 min CN=98 Runoff=0.04 cfs 118 cf Runoff Area=295 sf 100.00% Impervious Runoff Depth>3.50"Subcatchment 7c: Subcat 7c Tc=6.0 min CN=WQ Runoff=0.03 cfs 86 cf Runoff Area=1,004 sf 52.61% Impervious Runoff Depth>1.85"Subcatchment 8: Subcat 8 Tc=6.0 min CN=WQ Runoff=0.05 cfs 155 cf Runoff Area=1,884 sf 59.38% Impervious Runoff Depth>2.09"Subcatchment 8a: Subcat 8a Tc=6.0 min CN=WQ Runoff=0.11 cfs 328 cf Runoff Area=639 sf 99.98% Impervious Runoff Depth>3.50"Subcatchment 8b: Subcat 8b Tc=6.0 min CN=WQ Runoff=0.06 cfs 187 cf Runoff Area=1,712 sf 99.93% Impervious Runoff Depth>3.50"Subcatchment 8c: Subcat 8c Tc=6.0 min CN=WQ Runoff=0.16 cfs 499 cf NY-Nelson 24-hr S1 10-yr Rainfall=3.74"Post-Development Witt Nelson Printed 2/25/2026Prepared by The LA Group, PC Page 12HydroCAD® 10.20-4c s/n 00439 © 2024 HydroCAD Software Solutions LLC Runoff Area=1,248 sf 99.86% Impervious Runoff Depth>3.50"Subcatchment 9: Subcat 9 Tc=6.0 min CN=WQ Runoff=0.12 cfs 364 cf Runoff Area=599 sf 100.00% Impervious Runoff Depth>3.50"Subcatchment 9a: Subcat 9a Tc=6.0 min CN=98 Runoff=0.06 cfs 175 cf Runoff Area=348 sf 100.00% Impervious Runoff Depth>3.50"Subcatchment 9b: Subcat 9b Tc=6.0 min CN=98 Runoff=0.03 cfs 102 cf Runoff Area=323 sf 99.85% Impervious Runoff Depth>3.50"Subcatchment 9c: Subcat 9c Tc=6.0 min CN=WQ Runoff=0.03 cfs 94 cf Runoff Area=554 sf 99.78% Impervious Runoff Depth>3.50"Subcatchment 9e: Subcat 9e Tc=6.0 min CN=WQ Runoff=0.05 cfs 161 cf Runoff Area=890 sf 99.91% Impervious Runoff Depth>3.50"Subcatchment 10: Subcat 10 Tc=6.0 min CN=WQ Runoff=0.08 cfs 259 cf Runoff Area=517 sf 100.00% Impervious Runoff Depth>3.50"Subcatchment 10a: Subcat 10a Tc=6.0 min CN=WQ Runoff=0.05 cfs 151 cf Runoff Area=660 sf 100.00% Impervious Runoff Depth>3.50"Subcatchment 10b: Subcat 10b Tc=6.0 min CN=98 Runoff=0.06 cfs 193 cf Runoff Area=433 sf 100.00% Impervious Runoff Depth>3.50"Subcatchment 10c: Subcat 10c Tc=6.0 min CN=98 Runoff=0.04 cfs 127 cf Runoff Area=3,594 sf 98.17% Impervious Runoff Depth>3.44"Subcatchment 11: Subcat 11 Tc=6.0 min CN=WQ Runoff=0.33 cfs 1,030 cf Runoff Area=431 sf 99.94% Impervious Runoff Depth>3.50"Subcatchment 11a: Subcat 11a Tc=6.0 min CN=WQ Runoff=0.04 cfs 126 cf Runoff Area=567 sf 100.00% Impervious Runoff Depth>3.50"Subcatchment 12: Subcat 12 Tc=6.0 min CN=98 Runoff=0.05 cfs 166 cf Runoff Area=1,169 sf 99.99% Impervious Runoff Depth>3.50"Subcatchment 12a: Subcat 12a Tc=6.0 min CN=WQ Runoff=0.11 cfs 341 cf Runoff Area=680 sf 100.00% Impervious Runoff Depth>3.50"Subcatchment 12b: Subcat 12b Tc=6.0 min CN=WQ Runoff=0.06 cfs 198 cf Runoff Area=617 sf 100.00% Impervious Runoff Depth>3.50"Subcatchment 12c: Subcat 12c Tc=6.0 min CN=98 Runoff=0.06 cfs 180 cf Runoff Area=1,658 sf 100.00% Impervious Runoff Depth>3.50"Subcatchment 13: Subcat 13 Tc=6.0 min CN=98 Runoff=0.16 cfs 484 cf Runoff Area=736 sf 100.00% Impervious Runoff Depth>3.50"Subcatchment 13a: Subcat 13a Tc=6.0 min CN=98 Runoff=0.07 cfs 215 cf Runoff Area=622 sf 100.00% Impervious Runoff Depth>3.50"Subcatchment 13b: Subcat 13b Tc=6.0 min CN=98 Runoff=0.06 cfs 182 cf NY-Nelson 24-hr S1 10-yr Rainfall=3.74"Post-Development Witt Nelson Printed 2/25/2026Prepared by The LA Group, PC Page 13HydroCAD® 10.20-4c s/n 00439 © 2024 HydroCAD Software Solutions LLC Runoff Area=482 sf 100.00% Impervious Runoff Depth>3.50"Subcatchment 13c: Subcat 13c Tc=6.0 min CN=98 Runoff=0.05 cfs 141 cf Runoff Area=930 sf 99.91% Impervious Runoff Depth>3.50"Subcatchment 13d: Subcat 13d Tc=6.0 min CN=WQ Runoff=0.09 cfs 271 cf Runoff Area=1,004 sf 100.00% Impervious Runoff Depth>3.50"Subcatchment 13e: Subcat 13e Tc=6.0 min CN=98 Runoff=0.10 cfs 293 cf Runoff Area=1,218 sf 61.44% Impervious Runoff Depth>2.16"Subcatchment 13f: Subcat 13f Tc=6.0 min CN=WQ Runoff=0.07 cfs 219 cf Runoff Area=559 sf 75.15% Impervious Runoff Depth>2.64"Subcatchment 13g: Subcat 13g Tc=6.0 min CN=WQ Runoff=0.04 cfs 123 cf Runoff Area=5,077 sf 2.63% Impervious Runoff Depth>0.11"Subcatchment 14: Subcat 14 Tc=6.0 min CN=WQ Runoff=0.01 cfs 48 cf Runoff Area=2,714 sf 29.86% Impervious Runoff Depth>1.06"Subcatchment 15: Subcat 15 Tc=6.0 min CN=WQ Runoff=0.08 cfs 240 cf Runoff Area=2,068 sf 96.33% Impervious Runoff Depth>3.38"Subcatchment 16: Subcat 16 Tc=6.0 min CN=WQ Runoff=0.19 cfs 582 cf Runoff Area=1,626 sf 59.86% Impervious Runoff Depth>2.11"Subcatchment 17: Subcat 17 Tc=6.0 min CN=WQ Runoff=0.09 cfs 285 cf Runoff Area=4,406 sf 17.21% Impervious Runoff Depth>0.62"Subcatchment 18: Subcat 18 Tc=6.0 min CN=WQ Runoff=0.07 cfs 228 cf Runoff Area=3,307 sf 53.26% Impervious Runoff Depth>1.88"Subcatchment 19: Subcat 19 Tc=6.0 min CN=WQ Runoff=0.17 cfs 517 cf Runoff Area=919 sf 22.72% Impervious Runoff Depth>0.81"Subcatchment 19a: Subcat 19a Tc=6.0 min CN=WQ Runoff=0.02 cfs 62 cf Runoff Area=2,686 sf 86.02% Impervious Runoff Depth>3.02"Subcatchment 19b: Subcat 19b Tc=6.0 min CN=WQ Runoff=0.22 cfs 675 cf Runoff Area=2,805 sf 44.57% Impervious Runoff Depth>1.57"Subcatchment 20: Subcat 20 Tc=6.0 min CN=WQ Runoff=0.12 cfs 368 cf Runoff Area=1,851 sf 45.30% Impervious Runoff Depth>1.60"Subcatchment 21: Subcat 21 Tc=6.0 min CN=WQ Runoff=0.08 cfs 247 cf Runoff Area=1,178 sf 52.92% Impervious Runoff Depth>1.86"Subcatchment 22: Subcat 22 Tc=6.0 min CN=WQ Runoff=0.06 cfs 183 cf Runoff Area=4,258 sf 43.94% Impervious Runoff Depth>1.55"Subcatchment 23: Subcat 23 Tc=6.0 min CN=WQ Runoff=0.18 cfs 551 cf NY-Nelson 24-hr S1 10-yr Rainfall=3.74"Post-Development Witt Nelson Printed 2/25/2026Prepared by The LA Group, PC Page 14HydroCAD® 10.20-4c s/n 00439 © 2024 HydroCAD Software Solutions LLC Runoff Area=10,599 sf 79.73% Impervious Runoff Depth>2.80"Subcatchment 24: Subcat 24 Tc=6.0 min CN=WQ Runoff=0.80 cfs 2,471 cf Runoff Area=2,802 sf 49.36% Impervious Runoff Depth>1.74"Subcatchment 25: Subcat 25 Tc=6.0 min CN=WQ Runoff=0.13 cfs 406 cf Runoff Area=1,134 sf 37.07% Impervious Runoff Depth>1.31"Subcatchment 26: Subcat 26 Tc=6.0 min CN=WQ Runoff=0.04 cfs 124 cf Runoff Area=2,319 sf 62.46% Impervious Runoff Depth>2.20"Subcatchment 27: Subcat 27 Tc=6.0 min CN=WQ Runoff=0.14 cfs 424 cf Runoff Area=1,895 sf 81.22% Impervious Runoff Depth>2.85"Subcatchment 28: Subcat 28 Tc=6.0 min CN=WQ Runoff=0.15 cfs 450 cf Peak Elev=308.97' Inflow=0.04 cfs 131 cfPond 1P: YD-19 8.0" Round Culvert n=0.012 L=20.0' S=0.0500 '/' Outflow=0.04 cfs 131 cf Peak Elev=308.69' Inflow=0.10 cfs 318 cfPond 3P: YD-13 8.0" Round Culvert n=0.012 L=75.0' S=0.0100 '/' Outflow=0.10 cfs 318 cf Peak Elev=308.23' Inflow=0.32 cfs 982 cfPond 4P: YD-4 8.0" Round Culvert n=0.012 L=44.0' S=0.0100 '/' Outflow=0.32 cfs 982 cf Peak Elev=308.41' Inflow=0.22 cfs 690 cfPond 6P: YD-15 8.0" Round Culvert n=0.012 L=20.0' S=0.0500 '/' Outflow=0.22 cfs 690 cf Peak Elev=307.91' Inflow=0.58 cfs 1,794 cfPond 9P: YD-3 8.0" Round Culvert n=0.012 L=34.0' S=0.0100 '/' Outflow=0.58 cfs 1,794 cf Peak Elev=307.68' Inflow=0.12 cfs 363 cfPond 12P: YD-8 8.0" Round Culvert n=0.012 L=80.0' S=0.0100 '/' Outflow=0.12 cfs 363 cf Peak Elev=308.70' Inflow=0.17 cfs 537 cfPond 17P: Perf Header Pipe 12.0" Round Culvert n=0.012 L=115.0' S=0.0100 '/' Outflow=0.17 cfs 537 cf Peak Elev=307.49' Inflow=0.56 cfs 1,742 cfPond 18P: CB-1 12.0" Round Culvert n=0.012 L=63.0' S=0.0100 '/' Outflow=0.56 cfs 1,742 cf Peak Elev=308.97' Inflow=0.17 cfs 521 cfPond 21P: YD-20 8.0" Round Culvert n=0.012 L=20.0' S=0.0500 '/' Outflow=0.17 cfs 521 cf Peak Elev=308.97' Inflow=0.16 cfs 483 cfPond 23P: Perf Header Pipe 8.0" Round Culvert n=0.012 L=82.0' S=0.0100 '/' Outflow=0.16 cfs 483 cf Peak Elev=307.29' Inflow=1.06 cfs 3,268 cfPond 24P: YD-6 12.0" Round Culvert n=0.012 L=40.0' S=0.0050 '/' Outflow=1.06 cfs 3,267 cf Peak Elev=308.12' Inflow=0.41 cfs 1,278 cfPond 26P: YD-11 8.0" Round Culvert n=0.012 L=42.0' S=0.0100 '/' Outflow=0.41 cfs 1,278 cf Peak Elev=307.30' Inflow=0.50 cfs 1,537 cfPond 27P: YD-10 12.0" Round Culvert n=0.012 L=47.0' S=0.0049 '/' Outflow=0.50 cfs 1,537 cf NY-Nelson 24-hr S1 10-yr Rainfall=3.74"Post-Development Witt Nelson Printed 2/25/2026Prepared by The LA Group, PC Page 15HydroCAD® 10.20-4c s/n 00439 © 2024 HydroCAD Software Solutions LLC Peak Elev=307.24' Inflow=2.21 cfs 6,802 cfPond 29P: MH-1 18.0" Round Culvert n=0.012 L=9.0' S=0.0344 '/' Outflow=2.21 cfs 6,802 cf Peak Elev=308.34' Inflow=0.35 cfs 1,096 cfPond 31P: YD-16 8.0" Round Culvert n=0.012 L=20.0' S=0.0500 '/' Outflow=0.35 cfs 1,096 cf Peak Elev=308.97' Inflow=0.05 cfs 161 cfPond 33P: YD-18 8.0" Round Culvert n=0.012 L=20.0' S=0.0500 '/' Outflow=0.05 cfs 161 cf Peak Elev=308.97' Inflow=0.21 cfs 647 cfPond 34P: YD-21 8.0" Round Culvert n=0.012 L=20.0' S=0.0500 '/' Outflow=0.21 cfs 647 cf Peak Elev=308.16' Inflow=0.08 cfs 252 cfPond 35P: YD-22 8.0" Round Culvert n=0.012 L=65.0' S=0.0077 '/' Outflow=0.08 cfs 252 cf Peak Elev=303.96' Storage=201 cf Inflow=2.21 cfs 6,802 cfPond SMP-1: Chambers Outflow=1.53 cfs 6,822 cf Peak Elev=308.04' Storage=131 cf Inflow=1.50 cfs 4,635 cfPond SMP-2: Porous Pavers Outflow=1.05 cfs 4,637 cf Peak Elev=0.00' Storage=0 cf Inflow=0.04 cfs 123 cfPond SMP-2A: Porous Pavers Outflow=0.04 cfs 123 cf Peak Elev=303.52' Storage=1 cf Inflow=0.22 cfs 685 cfPond SMP-3A: Drywell Outflow=0.21 cfs 687 cf Peak Elev=303.50' Storage=0 cf Inflow=0.13 cfs 410 cfPond SMP-3B: Drywell Outflow=0.13 cfs 410 cf Peak Elev=308.97' Storage=252 cf Inflow=0.47 cfs 1,454 cfPond SMP-3C: Drywell Discarded=0.11 cfs 1,452 cf Secondary=0.02 cfs 6 cf Outflow=0.12 cfs 1,458 cf Peak Elev=304.30' Storage=12 cf Inflow=0.19 cfs 579 cfPond SMP-3D: Drywell Outflow=0.14 cfs 584 cf Peak Elev=308.00' Storage=0 cf Inflow=0.07 cfs 219 cfPond SMP-4A: Porous Pavement Outflow=0.07 cfs 219 cf Peak Elev=308.53' Storage=28 cf Inflow=0.33 cfs 1,030 cfPond SMP-4B: Porous Pavement Outflow=0.24 cfs 1,032 cf Peak Elev=308.51' Storage=8 cf Inflow=0.22 cfs 675 cfPond SMP-4C: Porous Pavement Outflow=0.18 cfs 679 cf Inflow=0.52 cfs 1,965 cfLink AP-1: AP-1 Primary=0.52 cfs 1,965 cf Inflow=0.39 cfs 1,205 cfLink AP-2: AP-2 Primary=0.39 cfs 1,205 cf NY-Nelson 24-hr S1 10-yr Rainfall=3.74"Post-Development Witt Nelson Printed 2/25/2026Prepared by The LA Group, PC Page 16HydroCAD® 10.20-4c s/n 00439 © 2024 HydroCAD Software Solutions LLC Total Runoff Area = 113,902 sf Runoff Volume = 19,778 cf Average Runoff Depth = 2.08" 40.77% Pervious = 46,442 sf 59.23% Impervious = 67,460 sf NY-Nelson 24-hr S1 100-yr Rainfall=6.27"Post-Development Witt Nelson Printed 2/25/2026Prepared by The LA Group, PC Page 1HydroCAD® 10.20-4c s/n 00439 © 2024 HydroCAD Software Solutions LLC Time span=0.00-24.00 hrs, dt=0.05 hrs, 481 points Runoff by SCS TR-20 method, UH=SCS, Weighted-Q Reach routing by Dyn-Stor-Ind method - Pond routing by Dyn-Stor-Ind method Runoff Area=24,700 sf 26.81% Impervious Runoff Depth>2.00"Subcatchment 1: Subcat 1 Flow Length=91' Tc=10.8 min CN=WQ Runoff=0.89 cfs 4,110 cf Runoff Area=5,682 sf 72.48% Impervious Runoff Depth>4.51"Subcatchment 2: Subcat 2 Tc=6.0 min CN=WQ Runoff=0.64 cfs 2,137 cf Runoff Area=2,224 sf 99.73% Impervious Runoff Depth>6.01"Subcatchment 4: Subcat 4 Tc=6.0 min CN=WQ Runoff=0.34 cfs 1,114 cf Runoff Area=863 sf 100.00% Impervious Runoff Depth>6.03"Subcatchment 4a: Subcat 4a Tc=6.0 min CN=98 Runoff=0.13 cfs 433 cf Runoff Area=377 sf 100.00% Impervious Runoff Depth>6.03"Subcatchment 4b: Subcat 4b Tc=6.0 min CN=98 Runoff=0.06 cfs 189 cf Runoff Area=450 sf 100.00% Impervious Runoff Depth>6.03"Subcatchment 5: Subcat 5 Tc=6.0 min CN=98 Runoff=0.07 cfs 226 cf Runoff Area=375 sf 100.00% Impervious Runoff Depth>6.03"Subcatchment 6: Subcat 6 Tc=6.0 min CN=98 Runoff=0.06 cfs 188 cf Runoff Area=404 sf 99.91% Impervious Runoff Depth>6.02"Subcatchment 6a: Subcat 6a Tc=6.0 min CN=WQ Runoff=0.06 cfs 203 cf Runoff Area=974 sf 100.00% Impervious Runoff Depth>6.03"Subcatchment 7: Subcat 7 Tc=6.0 min CN=WQ Runoff=0.15 cfs 489 cf Runoff Area=431 sf 99.99% Impervious Runoff Depth>6.03"Subcatchment 7a: Subcat 7a Tc=6.0 min CN=WQ Runoff=0.07 cfs 217 cf Runoff Area=405 sf 100.00% Impervious Runoff Depth>6.03"Subcatchment 7b: Subcat 7b Tc=6.0 min CN=98 Runoff=0.06 cfs 203 cf Runoff Area=295 sf 100.00% Impervious Runoff Depth>6.03"Subcatchment 7c: Subcat 7c Tc=6.0 min CN=WQ Runoff=0.05 cfs 148 cf Runoff Area=1,004 sf 52.61% Impervious Runoff Depth>3.42"Subcatchment 8: Subcat 8 Tc=6.0 min CN=WQ Runoff=0.08 cfs 286 cf Runoff Area=1,884 sf 59.38% Impervious Runoff Depth>3.79"Subcatchment 8a: Subcat 8a Tc=6.0 min CN=WQ Runoff=0.17 cfs 595 cf Runoff Area=639 sf 99.98% Impervious Runoff Depth>6.03"Subcatchment 8b: Subcat 8b Tc=6.0 min CN=WQ Runoff=0.10 cfs 321 cf Runoff Area=1,712 sf 99.93% Impervious Runoff Depth>6.02"Subcatchment 8c: Subcat 8c Tc=6.0 min CN=WQ Runoff=0.27 cfs 859 cf NY-Nelson 24-hr S1 100-yr Rainfall=6.27"Post-Development Witt Nelson Printed 2/25/2026Prepared by The LA Group, PC Page 2HydroCAD® 10.20-4c s/n 00439 © 2024 HydroCAD Software Solutions LLC Runoff Area=1,248 sf 99.86% Impervious Runoff Depth>6.02"Subcatchment 9: Subcat 9 Tc=6.0 min CN=WQ Runoff=0.19 cfs 626 cf Runoff Area=599 sf 100.00% Impervious Runoff Depth>6.03"Subcatchment 9a: Subcat 9a Tc=6.0 min CN=98 Runoff=0.09 cfs 301 cf Runoff Area=348 sf 100.00% Impervious Runoff Depth>6.03"Subcatchment 9b: Subcat 9b Tc=6.0 min CN=98 Runoff=0.05 cfs 175 cf Runoff Area=323 sf 99.85% Impervious Runoff Depth>6.02"Subcatchment 9c: Subcat 9c Tc=6.0 min CN=WQ Runoff=0.05 cfs 162 cf Runoff Area=554 sf 99.78% Impervious Runoff Depth>6.01"Subcatchment 9e: Subcat 9e Tc=6.0 min CN=WQ Runoff=0.09 cfs 278 cf Runoff Area=890 sf 99.91% Impervious Runoff Depth>6.02"Subcatchment 10: Subcat 10 Tc=6.0 min CN=WQ Runoff=0.14 cfs 446 cf Runoff Area=517 sf 100.00% Impervious Runoff Depth>6.03"Subcatchment 10a: Subcat 10a Tc=6.0 min CN=WQ Runoff=0.08 cfs 260 cf Runoff Area=660 sf 100.00% Impervious Runoff Depth>6.03"Subcatchment 10b: Subcat 10b Tc=6.0 min CN=98 Runoff=0.10 cfs 332 cf Runoff Area=433 sf 100.00% Impervious Runoff Depth>6.03"Subcatchment 10c: Subcat 10c Tc=6.0 min CN=98 Runoff=0.07 cfs 218 cf Runoff Area=3,594 sf 98.17% Impervious Runoff Depth>5.93"Subcatchment 11: Subcat 11 Tc=6.0 min CN=WQ Runoff=0.55 cfs 1,775 cf Runoff Area=431 sf 99.94% Impervious Runoff Depth>6.02"Subcatchment 11a: Subcat 11a Tc=6.0 min CN=WQ Runoff=0.07 cfs 216 cf Runoff Area=567 sf 100.00% Impervious Runoff Depth>6.03"Subcatchment 12: Subcat 12 Tc=6.0 min CN=98 Runoff=0.09 cfs 285 cf Runoff Area=1,169 sf 99.99% Impervious Runoff Depth>6.03"Subcatchment 12a: Subcat 12a Tc=6.0 min CN=WQ Runoff=0.18 cfs 587 cf Runoff Area=680 sf 100.00% Impervious Runoff Depth>6.03"Subcatchment 12b: Subcat 12b Tc=6.0 min CN=WQ Runoff=0.11 cfs 341 cf Runoff Area=617 sf 100.00% Impervious Runoff Depth>6.03"Subcatchment 12c: Subcat 12c Tc=6.0 min CN=98 Runoff=0.10 cfs 310 cf Runoff Area=1,658 sf 100.00% Impervious Runoff Depth>6.03"Subcatchment 13: Subcat 13 Tc=6.0 min CN=98 Runoff=0.26 cfs 833 cf Runoff Area=736 sf 100.00% Impervious Runoff Depth>6.03"Subcatchment 13a: Subcat 13a Tc=6.0 min CN=98 Runoff=0.11 cfs 370 cf Runoff Area=622 sf 100.00% Impervious Runoff Depth>6.03"Subcatchment 13b: Subcat 13b Tc=6.0 min CN=98 Runoff=0.10 cfs 313 cf NY-Nelson 24-hr S1 100-yr Rainfall=6.27"Post-Development Witt Nelson Printed 2/25/2026Prepared by The LA Group, PC Page 3HydroCAD® 10.20-4c s/n 00439 © 2024 HydroCAD Software Solutions LLC Runoff Area=482 sf 100.00% Impervious Runoff Depth>6.03"Subcatchment 13c: Subcat 13c Tc=6.0 min CN=98 Runoff=0.07 cfs 242 cf Runoff Area=930 sf 99.91% Impervious Runoff Depth>6.02"Subcatchment 13d: Subcat 13d Tc=6.0 min CN=WQ Runoff=0.14 cfs 467 cf Runoff Area=1,004 sf 100.00% Impervious Runoff Depth>6.03"Subcatchment 13e: Subcat 13e Tc=6.0 min CN=98 Runoff=0.16 cfs 504 cf Runoff Area=1,218 sf 61.44% Impervious Runoff Depth>3.90"Subcatchment 13f: Subcat 13f Tc=6.0 min CN=WQ Runoff=0.12 cfs 396 cf Runoff Area=559 sf 75.15% Impervious Runoff Depth>4.66"Subcatchment 13g: Subcat 13g Tc=6.0 min CN=WQ Runoff=0.07 cfs 217 cf Runoff Area=5,077 sf 2.63% Impervious Runoff Depth>0.67"Subcatchment 14: Subcat 14 Tc=6.0 min CN=WQ Runoff=0.03 cfs 283 cf Runoff Area=2,714 sf 29.86% Impervious Runoff Depth>2.17"Subcatchment 15: Subcat 15 Tc=6.0 min CN=WQ Runoff=0.13 cfs 490 cf Runoff Area=2,068 sf 96.33% Impervious Runoff Depth>5.83"Subcatchment 16: Subcat 16 Tc=6.0 min CN=WQ Runoff=0.31 cfs 1,004 cf Runoff Area=1,626 sf 59.86% Impervious Runoff Depth>3.82"Subcatchment 17: Subcat 17 Tc=6.0 min CN=WQ Runoff=0.15 cfs 517 cf Runoff Area=4,406 sf 17.21% Impervious Runoff Depth>1.47"Subcatchment 18: Subcat 18 Tc=6.0 min CN=WQ Runoff=0.12 cfs 540 cf Runoff Area=3,307 sf 53.26% Impervious Runoff Depth>3.45"Subcatchment 19: Subcat 19 Tc=6.0 min CN=WQ Runoff=0.28 cfs 952 cf Runoff Area=919 sf 22.72% Impervious Runoff Depth>1.77"Subcatchment 19a: Subcat 19a Tc=6.0 min CN=WQ Runoff=0.03 cfs 136 cf Runoff Area=2,686 sf 86.02% Impervious Runoff Depth>5.26"Subcatchment 19b: Subcat 19b Tc=6.0 min CN=WQ Runoff=0.36 cfs 1,177 cf Runoff Area=2,805 sf 44.57% Impervious Runoff Depth>2.98"Subcatchment 20: Subcat 20 Tc=6.0 min CN=WQ Runoff=0.20 cfs 696 cf Runoff Area=1,851 sf 45.30% Impervious Runoff Depth>3.02"Subcatchment 21: Subcat 21 Tc=6.0 min CN=WQ Runoff=0.13 cfs 465 cf Runoff Area=1,178 sf 52.92% Impervious Runoff Depth>3.44"Subcatchment 22: Subcat 22 Tc=6.0 min CN=WQ Runoff=0.10 cfs 337 cf Runoff Area=4,258 sf 43.94% Impervious Runoff Depth>2.94"Subcatchment 23: Subcat 23 Tc=6.0 min CN=WQ Runoff=0.29 cfs 1,044 cf NY-Nelson 24-hr S1 100-yr Rainfall=6.27"Post-Development Witt Nelson Printed 2/25/2026Prepared by The LA Group, PC Page 4HydroCAD® 10.20-4c s/n 00439 © 2024 HydroCAD Software Solutions LLC Runoff Area=10,599 sf 79.73% Impervious Runoff Depth>4.91"Subcatchment 24: Subcat 24 Tc=6.0 min CN=WQ Runoff=1.31 cfs 4,338 cf Runoff Area=2,802 sf 49.36% Impervious Runoff Depth>3.24"Subcatchment 25: Subcat 25 Tc=6.0 min CN=WQ Runoff=0.22 cfs 757 cf Runoff Area=1,134 sf 37.07% Impervious Runoff Depth>2.56"Subcatchment 26: Subcat 26 Tc=6.0 min CN=WQ Runoff=0.07 cfs 242 cf Runoff Area=2,319 sf 62.46% Impervious Runoff Depth>3.96"Subcatchment 27: Subcat 27 Tc=6.0 min CN=WQ Runoff=0.23 cfs 765 cf Runoff Area=1,895 sf 81.22% Impervious Runoff Depth>4.99"Subcatchment 28: Subcat 28 Tc=6.0 min CN=WQ Runoff=0.24 cfs 788 cf Peak Elev=309.48' Inflow=0.07 cfs 226 cfPond 1P: YD-19 8.0" Round Culvert n=0.012 L=20.0' S=0.0500 '/' Outflow=0.07 cfs 226 cf Peak Elev=308.75' Inflow=0.17 cfs 548 cfPond 3P: YD-13 8.0" Round Culvert n=0.012 L=75.0' S=0.0100 '/' Outflow=0.17 cfs 548 cf Peak Elev=308.38' Inflow=0.52 cfs 1,786 cfPond 4P: YD-4 8.0" Round Culvert n=0.012 L=44.0' S=0.0100 '/' Outflow=0.52 cfs 1,786 cf Peak Elev=308.53' Inflow=0.37 cfs 1,187 cfPond 6P: YD-15 8.0" Round Culvert n=0.012 L=20.0' S=0.0500 '/' Outflow=0.37 cfs 1,187 cf Peak Elev=308.10' Inflow=0.95 cfs 3,183 cfPond 9P: YD-3 8.0" Round Culvert n=0.012 L=34.0' S=0.0100 '/' Outflow=0.95 cfs 3,183 cf Peak Elev=307.79' Inflow=0.19 cfs 647 cfPond 12P: YD-8 8.0" Round Culvert n=0.012 L=80.0' S=0.0100 '/' Outflow=0.19 cfs 647 cf Peak Elev=308.76' Inflow=0.29 cfs 924 cfPond 17P: Perf Header Pipe 12.0" Round Culvert n=0.012 L=115.0' S=0.0100 '/' Outflow=0.29 cfs 924 cf Peak Elev=307.69' Inflow=0.93 cfs 3,061 cfPond 18P: CB-1 12.0" Round Culvert n=0.012 L=63.0' S=0.0100 '/' Outflow=0.93 cfs 3,061 cf Peak Elev=309.48' Inflow=0.28 cfs 1,044 cfPond 21P: YD-20 8.0" Round Culvert n=0.012 L=20.0' S=0.0500 '/' Outflow=0.28 cfs 1,044 cf Peak Elev=309.03' Inflow=0.26 cfs 881 cfPond 23P: Perf Header Pipe 8.0" Round Culvert n=0.012 L=82.0' S=0.0100 '/' Outflow=0.26 cfs 881 cf Peak Elev=307.64' Inflow=1.74 cfs 5,771 cfPond 24P: YD-6 12.0" Round Culvert n=0.012 L=40.0' S=0.0050 '/' Outflow=1.74 cfs 5,771 cf Peak Elev=308.26' Inflow=0.68 cfs 2,291 cfPond 26P: YD-11 8.0" Round Culvert n=0.012 L=42.0' S=0.0100 '/' Outflow=0.68 cfs 2,291 cf Peak Elev=307.66' Inflow=0.82 cfs 2,737 cfPond 27P: YD-10 12.0" Round Culvert n=0.012 L=47.0' S=0.0049 '/' Outflow=0.82 cfs 2,737 cf NY-Nelson 24-hr S1 100-yr Rainfall=6.27"Post-Development Witt Nelson Printed 2/25/2026Prepared by The LA Group, PC Page 5HydroCAD® 10.20-4c s/n 00439 © 2024 HydroCAD Software Solutions LLC Peak Elev=307.48' Inflow=3.62 cfs 12,016 cfPond 29P: MH-1 18.0" Round Culvert n=0.012 L=9.0' S=0.0344 '/' Outflow=3.62 cfs 12,016 cf Peak Elev=308.45' Inflow=0.58 cfs 1,943 cfPond 31P: YD-16 8.0" Round Culvert n=0.012 L=20.0' S=0.0500 '/' Outflow=0.58 cfs 1,943 cf Peak Elev=309.48' Inflow=0.09 cfs 278 cfPond 33P: YD-18 8.0" Round Culvert n=0.012 L=20.0' S=0.0500 '/' Outflow=0.09 cfs 278 cf Peak Elev=309.48' Inflow=0.34 cfs 1,114 cfPond 34P: YD-21 8.0" Round Culvert n=0.012 L=20.0' S=0.0500 '/' Outflow=0.34 cfs 1,114 cf Peak Elev=308.21' Inflow=0.13 cfs 433 cfPond 35P: YD-22 8.0" Round Culvert n=0.012 L=65.0' S=0.0077 '/' Outflow=0.13 cfs 433 cf Peak Elev=304.97' Storage=1,064 cf Inflow=3.62 cfs 12,016 cfPond SMP-1: Chambers Outflow=1.53 cfs 12,073 cf Peak Elev=308.29' Storage=1,054 cf Inflow=3.22 cfs 8,619 cfPond SMP-2: Porous Pavers Outflow=1.05 cfs 8,661 cf Peak Elev=0.00' Storage=0 cf Inflow=0.07 cfs 217 cfPond SMP-2A: Porous Pavers Outflow=0.07 cfs 217 cf Peak Elev=304.51' Storage=62 cf Inflow=0.37 cfs 1,297 cfPond SMP-3A: Drywell Outflow=0.21 cfs 1,302 cf Peak Elev=304.25' Storage=30 cf Inflow=0.22 cfs 906 cfPond SMP-3B: Drywell Outflow=0.14 cfs 907 cf Peak Elev=309.46' Storage=279 cf Inflow=0.77 cfs 2,675 cfPond SMP-3C: Drywell Discarded=0.11 cfs 2,169 cf Secondary=0.80 cfs 507 cf Outflow=0.90 cfs 2,676 cf Peak Elev=305.58' Storage=83 cf Inflow=0.31 cfs 1,088 cfPond SMP-3D: Drywell Outflow=0.14 cfs 1,094 cf Peak Elev=308.05' Storage=14 cf Inflow=0.12 cfs 396 cfPond SMP-4A: Porous Pavement Outflow=0.08 cfs 399 cf Peak Elev=308.69' Storage=153 cf Inflow=0.55 cfs 1,775 cfPond SMP-4B: Porous Pavement Outflow=0.24 cfs 1,788 cf Peak Elev=308.63' Storage=79 cf Inflow=0.36 cfs 1,177 cfPond SMP-4C: Porous Pavement Outflow=0.18 cfs 1,181 cf Inflow=0.89 cfs 4,110 cfLink AP-1: AP-1 Primary=0.89 cfs 4,110 cf Inflow=0.64 cfs 2,137 cfLink AP-2: AP-2 Primary=0.64 cfs 2,137 cf NY-Nelson 24-hr S1 100-yr Rainfall=6.27"Post-Development Witt Nelson Printed 2/25/2026Prepared by The LA Group, PC Page 6HydroCAD® 10.20-4c s/n 00439 © 2024 HydroCAD Software Solutions LLC Total Runoff Area = 113,902 sf Runoff Volume = 35,904 cf Average Runoff Depth = 3.78" 40.77% Pervious = 46,442 sf 59.23% Impervious = 67,460 sf NY-Nelson 24-hr S1 100-yr Rainfall=6.27"Post-Development Witt Nelson Printed 2/25/2026Prepared by The LA Group, PC Page 7HydroCAD® 10.20-4c s/n 00439 © 2024 HydroCAD Software Solutions LLC Summary for Subcatchment 1: Subcat 1 Runoff = 0.89 cfs @ 12.11 hrs, Volume= 4,110 cf, Depth> 2.00" Routed to Link AP-1 : AP-1 Runoff by SCS TR-20 method, UH=SCS, Weighted-Q, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs NY-Nelson 24-hr S1 100-yr Rainfall=6.27" Area (sf) CN Description 18,079 39 >75% Grass cover, Good, HSG A 6,621 98 Paved parking, HSG A 24,700 Weighted Average 18,079 73.19% Pervious Area 6,621 26.81% Impervious Area Tc Length Slope Velocity Capacity Description (min) (feet) (ft/ft) (ft/sec) (cfs) 10.7 85 0.0150 0.13 Sheet Flow, Grass: Short n= 0.150 P2= 2.61" 0.1 6 0.0200 0.71 Sheet Flow, Smooth surfaces n= 0.011 P2= 2.61" 10.8 91 Total Summary for Subcatchment 2: Subcat 2 Runoff = 0.64 cfs @ 12.04 hrs, Volume= 2,137 cf, Depth> 4.51" Routed to Link AP-2 : AP-2 Runoff by SCS TR-20 method, UH=SCS, Weighted-Q, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs NY-Nelson 24-hr S1 100-yr Rainfall=6.27" Area (sf) CN Description 1,564 39 >75% Grass cover, Good, HSG A 4,118 98 Paved parking, HSG A 5,682 Weighted Average 1,564 27.52% Pervious Area 4,118 72.48% Impervious Area Tc Length Slope Velocity Capacity Description (min) (feet) (ft/ft) (ft/sec) (cfs) 6.0 Direct Entry, Summary for Subcatchment 4: Subcat 4 Runoff = 0.34 cfs @ 12.04 hrs, Volume= 1,114 cf, Depth> 6.01" Routed to Pond 34P : YD-21 Runoff by SCS TR-20 method, UH=SCS, Weighted-Q, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs NY-Nelson 24-hr S1 100-yr Rainfall=6.27" NY-Nelson 24-hr S1 100-yr Rainfall=6.27"Post-Development Witt Nelson Printed 2/25/2026Prepared by The LA Group, PC Page 8HydroCAD® 10.20-4c s/n 00439 © 2024 HydroCAD Software Solutions LLC Area (sf) CN Description 6 39 >75% Grass cover, Good, HSG A 2,218 98 Paved parking, HSG A 2,224 Weighted Average 6 0.27% Pervious Area 2,218 99.73% Impervious Area Tc Length Slope Velocity Capacity Description (min) (feet) (ft/ft) (ft/sec) (cfs) 6.0 Direct Entry, Summary for Subcatchment 4a: Subcat 4a Runoff = 0.13 cfs @ 12.04 hrs, Volume= 433 cf, Depth> 6.03" Routed to Pond 35P : YD-22 Runoff by SCS TR-20 method, UH=SCS, Weighted-Q, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs NY-Nelson 24-hr S1 100-yr Rainfall=6.27" Area (sf) CN Description 863 98 Paved parking, HSG A 863 100.00% Impervious Area Tc Length Slope Velocity Capacity Description (min) (feet) (ft/ft) (ft/sec) (cfs) 6.0 Direct Entry, Summary for Subcatchment 4b: Subcat 4b Runoff = 0.06 cfs @ 12.04 hrs, Volume= 189 cf, Depth> 6.03" Routed to Pond SMP-3B : Drywell Runoff by SCS TR-20 method, UH=SCS, Weighted-Q, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs NY-Nelson 24-hr S1 100-yr Rainfall=6.27" Area (sf) CN Description 377 98 Paved parking, HSG A 377 100.00% Impervious Area Tc Length Slope Velocity Capacity Description (min) (feet) (ft/ft) (ft/sec) (cfs) 6.0 Direct Entry, Summary for Subcatchment 5: Subcat 5 Runoff = 0.07 cfs @ 12.04 hrs, Volume= 226 cf, Depth> 6.03" Routed to Pond 1P : YD-19 Runoff by SCS TR-20 method, UH=SCS, Weighted-Q, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs NY-Nelson 24-hr S1 100-yr Rainfall=6.27" NY-Nelson 24-hr S1 100-yr Rainfall=6.27"Post-Development Witt Nelson Printed 2/25/2026Prepared by The LA Group, PC Page 9HydroCAD® 10.20-4c s/n 00439 © 2024 HydroCAD Software Solutions LLC Area (sf) CN Description 450 98 Paved parking, HSG A 450 100.00% Impervious Area Tc Length Slope Velocity Capacity Description (min) (feet) (ft/ft) (ft/sec) (cfs) 6.0 Direct Entry, Summary for Subcatchment 6: Subcat 6 Runoff = 0.06 cfs @ 12.04 hrs, Volume= 188 cf, Depth> 6.03" Routed to Pond 4P : YD-4 Runoff by SCS TR-20 method, UH=SCS, Weighted-Q, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs NY-Nelson 24-hr S1 100-yr Rainfall=6.27" Area (sf) CN Description 375 98 Paved parking, HSG A 375 100.00% Impervious Area Tc Length Slope Velocity Capacity Description (min) (feet) (ft/ft) (ft/sec) (cfs) 6.0 Direct Entry, Summary for Subcatchment 6a: Subcat 6a Runoff = 0.06 cfs @ 12.04 hrs, Volume= 203 cf, Depth> 6.02" Routed to Pond 4P : YD-4 Runoff by SCS TR-20 method, UH=SCS, Weighted-Q, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs NY-Nelson 24-hr S1 100-yr Rainfall=6.27" Area (sf) CN Description 0 39 >75% Grass cover, Good, HSG A 404 98 Paved parking, HSG A 404 Weighted Average 0 0.09% Pervious Area 404 99.91% Impervious Area Tc Length Slope Velocity Capacity Description (min) (feet) (ft/ft) (ft/sec) (cfs) 6.0 Direct Entry, NY-Nelson 24-hr S1 100-yr Rainfall=6.27"Post-Development Witt Nelson Printed 2/25/2026Prepared by The LA Group, PC Page 10HydroCAD® 10.20-4c s/n 00439 © 2024 HydroCAD Software Solutions LLC Summary for Subcatchment 7: Subcat 7 Runoff = 0.15 cfs @ 12.04 hrs, Volume= 489 cf, Depth> 6.03" Routed to Pond SMP-2 : Porous Pavers Runoff by SCS TR-20 method, UH=SCS, Weighted-Q, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs NY-Nelson 24-hr S1 100-yr Rainfall=6.27" Area (sf) CN Description 0 39 >75% Grass cover, Good, HSG A 974 98 Paved parking, HSG A 974 Weighted Average 0 0.00% Pervious Area 974 100.00% Impervious Area Tc Length Slope Velocity Capacity Description (min) (feet) (ft/ft) (ft/sec) (cfs) 6.0 Direct Entry, Summary for Subcatchment 7a: Subcat 7a Runoff = 0.07 cfs @ 12.04 hrs, Volume= 217 cf, Depth> 6.03" Routed to Pond 9P : YD-3 Runoff by SCS TR-20 method, UH=SCS, Weighted-Q, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs NY-Nelson 24-hr S1 100-yr Rainfall=6.27" Area (sf) CN Description 0 39 >75% Grass cover, Good, HSG A 431 98 Paved parking, HSG A 431 Weighted Average 0 0.01% Pervious Area 431 99.99% Impervious Area Tc Length Slope Velocity Capacity Description (min) (feet) (ft/ft) (ft/sec) (cfs) 6.0 Direct Entry, Summary for Subcatchment 7b: Subcat 7b Runoff = 0.06 cfs @ 12.04 hrs, Volume= 203 cf, Depth> 6.03" Routed to Pond 4P : YD-4 Runoff by SCS TR-20 method, UH=SCS, Weighted-Q, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs NY-Nelson 24-hr S1 100-yr Rainfall=6.27" NY-Nelson 24-hr S1 100-yr Rainfall=6.27"Post-Development Witt Nelson Printed 2/25/2026Prepared by The LA Group, PC Page 11HydroCAD® 10.20-4c s/n 00439 © 2024 HydroCAD Software Solutions LLC Area (sf) CN Description 405 98 Paved parking, HSG A 405 100.00% Impervious Area Tc Length Slope Velocity Capacity Description (min) (feet) (ft/ft) (ft/sec) (cfs) 6.0 Direct Entry, Summary for Subcatchment 7c: Subcat 7c Runoff = 0.05 cfs @ 12.04 hrs, Volume= 148 cf, Depth> 6.03" Routed to Pond 4P : YD-4 Runoff by SCS TR-20 method, UH=SCS, Weighted-Q, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs NY-Nelson 24-hr S1 100-yr Rainfall=6.27" Area (sf) CN Description 0 39 >75% Grass cover, Good, HSG A 295 98 Paved parking, HSG A 295 Weighted Average 0 0.00% Pervious Area 295 100.00% Impervious Area Tc Length Slope Velocity Capacity Description (min) (feet) (ft/ft) (ft/sec) (cfs) 6.0 Direct Entry, Summary for Subcatchment 8: Subcat 8 Runoff = 0.08 cfs @ 12.04 hrs, Volume= 286 cf, Depth> 3.42" Routed to Pond 23P : Perf Header Pipe Runoff by SCS TR-20 method, UH=SCS, Weighted-Q, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs NY-Nelson 24-hr S1 100-yr Rainfall=6.27" Area (sf) CN Description 476 39 >75% Grass cover, Good, HSG A 528 98 Paved parking, HSG A 1,004 Weighted Average 476 47.39% Pervious Area 528 52.61% Impervious Area Tc Length Slope Velocity Capacity Description (min) (feet) (ft/ft) (ft/sec) (cfs) 6.0 Direct Entry, NY-Nelson 24-hr S1 100-yr Rainfall=6.27"Post-Development Witt Nelson Printed 2/25/2026Prepared by The LA Group, PC Page 12HydroCAD® 10.20-4c s/n 00439 © 2024 HydroCAD Software Solutions LLC Summary for Subcatchment 8a: Subcat 8a Runoff = 0.17 cfs @ 12.04 hrs, Volume= 595 cf, Depth> 3.79" Routed to Pond 23P : Perf Header Pipe Runoff by SCS TR-20 method, UH=SCS, Weighted-Q, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs NY-Nelson 24-hr S1 100-yr Rainfall=6.27" Area (sf) CN Description 765 39 >75% Grass cover, Good, HSG A 1,119 98 Paved parking, HSG A 1,884 Weighted Average 765 40.62% Pervious Area 1,119 59.38% Impervious Area Tc Length Slope Velocity Capacity Description (min) (feet) (ft/ft) (ft/sec) (cfs) 6.0 Direct Entry, Summary for Subcatchment 8b: Subcat 8b Runoff = 0.10 cfs @ 12.04 hrs, Volume= 321 cf, Depth> 6.03" Routed to Pond 9P : YD-3 Runoff by SCS TR-20 method, UH=SCS, Weighted-Q, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs NY-Nelson 24-hr S1 100-yr Rainfall=6.27" Area (sf) CN Description 0 39 >75% Grass cover, Good, HSG A 639 98 Paved parking, HSG A 639 Weighted Average 0 0.02% Pervious Area 639 99.98% Impervious Area Tc Length Slope Velocity Capacity Description (min) (feet) (ft/ft) (ft/sec) (cfs) 6.0 Direct Entry, Summary for Subcatchment 8c: Subcat 8c Runoff = 0.27 cfs @ 12.04 hrs, Volume= 859 cf, Depth> 6.02" Routed to Pond 9P : YD-3 Runoff by SCS TR-20 method, UH=SCS, Weighted-Q, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs NY-Nelson 24-hr S1 100-yr Rainfall=6.27" NY-Nelson 24-hr S1 100-yr Rainfall=6.27"Post-Development Witt Nelson Printed 2/25/2026Prepared by The LA Group, PC Page 13HydroCAD® 10.20-4c s/n 00439 © 2024 HydroCAD Software Solutions LLC Area (sf) CN Description 1 39 >75% Grass cover, Good, HSG A 1,711 98 Paved parking, HSG A 1,712 Weighted Average 1 0.07% Pervious Area 1,711 99.93% Impervious Area Tc Length Slope Velocity Capacity Description (min) (feet) (ft/ft) (ft/sec) (cfs) 6.0 Direct Entry, Summary for Subcatchment 9: Subcat 9 Runoff = 0.19 cfs @ 12.04 hrs, Volume= 626 cf, Depth> 6.02" Routed to Pond 6P : YD-15 Runoff by SCS TR-20 method, UH=SCS, Weighted-Q, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs NY-Nelson 24-hr S1 100-yr Rainfall=6.27" Area (sf) CN Description 2 39 >75% Grass cover, Good, HSG A 1,246 98 Paved parking, HSG A 1,248 Weighted Average 2 0.14% Pervious Area 1,246 99.86% Impervious Area Tc Length Slope Velocity Capacity Description (min) (feet) (ft/ft) (ft/sec) (cfs) 6.0 Direct Entry, Summary for Subcatchment 9a: Subcat 9a Runoff = 0.09 cfs @ 12.04 hrs, Volume= 301 cf, Depth> 6.03" Routed to Pond 6P : YD-15 Runoff by SCS TR-20 method, UH=SCS, Weighted-Q, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs NY-Nelson 24-hr S1 100-yr Rainfall=6.27" Area (sf) CN Description 599 98 Paved parking, HSG A 599 100.00% Impervious Area Tc Length Slope Velocity Capacity Description (min) (feet) (ft/ft) (ft/sec) (cfs) 6.0 Direct Entry, NY-Nelson 24-hr S1 100-yr Rainfall=6.27"Post-Development Witt Nelson Printed 2/25/2026Prepared by The LA Group, PC Page 14HydroCAD® 10.20-4c s/n 00439 © 2024 HydroCAD Software Solutions LLC Summary for Subcatchment 9b: Subcat 9b Runoff = 0.05 cfs @ 12.04 hrs, Volume= 175 cf, Depth> 6.03" Routed to Pond SMP-2 : Porous Pavers Runoff by SCS TR-20 method, UH=SCS, Weighted-Q, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs NY-Nelson 24-hr S1 100-yr Rainfall=6.27" Area (sf) CN Description 348 98 Paved parking, HSG A 348 100.00% Impervious Area Tc Length Slope Velocity Capacity Description (min) (feet) (ft/ft) (ft/sec) (cfs) 6.0 Direct Entry, Summary for Subcatchment 9c: Subcat 9c Runoff = 0.05 cfs @ 12.04 hrs, Volume= 162 cf, Depth> 6.02" Routed to Pond SMP-2 : Porous Pavers Runoff by SCS TR-20 method, UH=SCS, Weighted-Q, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs NY-Nelson 24-hr S1 100-yr Rainfall=6.27" Area (sf) CN Description 1 39 >75% Grass cover, Good, HSG A 323 98 Paved parking, HSG A 323 Weighted Average 1 0.15% Pervious Area 323 99.85% Impervious Area Tc Length Slope Velocity Capacity Description (min) (feet) (ft/ft) (ft/sec) (cfs) 6.0 Direct Entry, Summary for Subcatchment 9e: Subcat 9e Runoff = 0.09 cfs @ 12.04 hrs, Volume= 278 cf, Depth> 6.01" Routed to Pond 33P : YD-18 Runoff by SCS TR-20 method, UH=SCS, Weighted-Q, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs NY-Nelson 24-hr S1 100-yr Rainfall=6.27" Area (sf) CN Description 1 39 >75% Grass cover, Good, HSG A 553 98 Paved parking, HSG A 554 Weighted Average 1 0.22% Pervious Area 553 99.78% Impervious Area NY-Nelson 24-hr S1 100-yr Rainfall=6.27"Post-Development Witt Nelson Printed 2/25/2026Prepared by The LA Group, PC Page 15HydroCAD® 10.20-4c s/n 00439 © 2024 HydroCAD Software Solutions LLC Tc Length Slope Velocity Capacity Description (min) (feet) (ft/ft) (ft/sec) (cfs) 6.0 Direct Entry, Summary for Subcatchment 10: Subcat 10 Runoff = 0.14 cfs @ 12.04 hrs, Volume= 446 cf, Depth> 6.02" Routed to Pond 27P : YD-10 Runoff by SCS TR-20 method, UH=SCS, Weighted-Q, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs NY-Nelson 24-hr S1 100-yr Rainfall=6.27" Area (sf) CN Description 1 39 >75% Grass cover, Good, HSG A 889 98 Paved parking, HSG A 890 Weighted Average 1 0.09% Pervious Area 889 99.91% Impervious Area Tc Length Slope Velocity Capacity Description (min) (feet) (ft/ft) (ft/sec) (cfs) 6.0 Direct Entry, Summary for Subcatchment 10a: Subcat 10a Runoff = 0.08 cfs @ 12.04 hrs, Volume= 260 cf, Depth> 6.03" Routed to Pond 6P : YD-15 Runoff by SCS TR-20 method, UH=SCS, Weighted-Q, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs NY-Nelson 24-hr S1 100-yr Rainfall=6.27" Area (sf) CN Description 0 39 >75% Grass cover, Good, HSG A 517 98 Paved parking, HSG A 517 Weighted Average 0 0.00% Pervious Area 517 100.00% Impervious Area Tc Length Slope Velocity Capacity Description (min) (feet) (ft/ft) (ft/sec) (cfs) 6.0 Direct Entry, Summary for Subcatchment 10b: Subcat 10b Runoff = 0.10 cfs @ 12.04 hrs, Volume= 332 cf, Depth> 6.03" Routed to Pond 3P : YD-13 Runoff by SCS TR-20 method, UH=SCS, Weighted-Q, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs NY-Nelson 24-hr S1 100-yr Rainfall=6.27" NY-Nelson 24-hr S1 100-yr Rainfall=6.27"Post-Development Witt Nelson Printed 2/25/2026Prepared by The LA Group, PC Page 16HydroCAD® 10.20-4c s/n 00439 © 2024 HydroCAD Software Solutions LLC Area (sf) CN Description 660 98 Paved parking, HSG A 660 100.00% Impervious Area Tc Length Slope Velocity Capacity Description (min) (feet) (ft/ft) (ft/sec) (cfs) 6.0 Direct Entry, Summary for Subcatchment 10c: Subcat 10c Runoff = 0.07 cfs @ 12.04 hrs, Volume= 218 cf, Depth> 6.03" Routed to Pond 26P : YD-11 Runoff by SCS TR-20 method, UH=SCS, Weighted-Q, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs NY-Nelson 24-hr S1 100-yr Rainfall=6.27" Area (sf) CN Description 433 98 Paved parking, HSG A 433 100.00% Impervious Area Tc Length Slope Velocity Capacity Description (min) (feet) (ft/ft) (ft/sec) (cfs) 6.0 Direct Entry, Summary for Subcatchment 11: Subcat 11 Runoff = 0.55 cfs @ 12.04 hrs, Volume= 1,775 cf, Depth> 5.93" Routed to Pond SMP-4B : Porous Pavement Runoff by SCS TR-20 method, UH=SCS, Weighted-Q, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs NY-Nelson 24-hr S1 100-yr Rainfall=6.27" Area (sf) CN Description 66 39 >75% Grass cover, Good, HSG A 3,528 98 Paved parking, HSG A 3,594 Weighted Average 66 1.83% Pervious Area 3,528 98.17% Impervious Area Tc Length Slope Velocity Capacity Description (min) (feet) (ft/ft) (ft/sec) (cfs) 6.0 Direct Entry, Summary for Subcatchment 11a: Subcat 11a Runoff = 0.07 cfs @ 12.04 hrs, Volume= 216 cf, Depth> 6.02" Routed to Pond 3P : YD-13 Runoff by SCS TR-20 method, UH=SCS, Weighted-Q, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs NY-Nelson 24-hr S1 100-yr Rainfall=6.27" NY-Nelson 24-hr S1 100-yr Rainfall=6.27"Post-Development Witt Nelson Printed 2/25/2026Prepared by The LA Group, PC Page 17HydroCAD® 10.20-4c s/n 00439 © 2024 HydroCAD Software Solutions LLC Area (sf) CN Description 0 39 >75% Grass cover, Good, HSG A 431 98 Paved parking, HSG A 431 Weighted Average 0 0.06% Pervious Area 431 99.94% Impervious Area Tc Length Slope Velocity Capacity Description (min) (feet) (ft/ft) (ft/sec) (cfs) 6.0 Direct Entry, Summary for Subcatchment 12: Subcat 12 Runoff = 0.09 cfs @ 12.04 hrs, Volume= 285 cf, Depth> 6.03" Routed to Pond 24P : YD-6 Runoff by SCS TR-20 method, UH=SCS, Weighted-Q, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs NY-Nelson 24-hr S1 100-yr Rainfall=6.27" Area (sf) CN Description 567 98 Paved parking, HSG A 567 100.00% Impervious Area Tc Length Slope Velocity Capacity Description (min) (feet) (ft/ft) (ft/sec) (cfs) 6.0 Direct Entry, Summary for Subcatchment 12a: Subcat 12a Runoff = 0.18 cfs @ 12.04 hrs, Volume= 587 cf, Depth> 6.03" Routed to Pond 26P : YD-11 Runoff by SCS TR-20 method, UH=SCS, Weighted-Q, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs NY-Nelson 24-hr S1 100-yr Rainfall=6.27" Area (sf) CN Description 0 39 >75% Grass cover, Good, HSG A 1,169 98 Paved parking, HSG A 1,169 Weighted Average 0 0.01% Pervious Area 1,169 99.99% Impervious Area Tc Length Slope Velocity Capacity Description (min) (feet) (ft/ft) (ft/sec) (cfs) 6.0 Direct Entry, NY-Nelson 24-hr S1 100-yr Rainfall=6.27"Post-Development Witt Nelson Printed 2/25/2026Prepared by The LA Group, PC Page 18HydroCAD® 10.20-4c s/n 00439 © 2024 HydroCAD Software Solutions LLC Summary for Subcatchment 12b: Subcat 12b Runoff = 0.11 cfs @ 12.04 hrs, Volume= 341 cf, Depth> 6.03" Routed to Pond SMP-3A : Drywell Runoff by SCS TR-20 method, UH=SCS, Weighted-Q, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs NY-Nelson 24-hr S1 100-yr Rainfall=6.27" Area (sf) CN Description 0 39 >75% Grass cover, Good, HSG A 680 98 Paved parking, HSG A 680 Weighted Average 0 0.00% Pervious Area 680 100.00% Impervious Area Tc Length Slope Velocity Capacity Description (min) (feet) (ft/ft) (ft/sec) (cfs) 6.0 Direct Entry, Summary for Subcatchment 12c: Subcat 12c Runoff = 0.10 cfs @ 12.04 hrs, Volume= 310 cf, Depth> 6.03" Routed to Pond 12P : YD-8 Runoff by SCS TR-20 method, UH=SCS, Weighted-Q, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs NY-Nelson 24-hr S1 100-yr Rainfall=6.27" Area (sf) CN Description 617 98 Paved parking, HSG A 617 100.00% Impervious Area Tc Length Slope Velocity Capacity Description (min) (feet) (ft/ft) (ft/sec) (cfs) 6.0 Direct Entry, Summary for Subcatchment 13: Subcat 13 Runoff = 0.26 cfs @ 12.04 hrs, Volume= 833 cf, Depth> 6.03" Routed to Pond 24P : YD-6 Runoff by SCS TR-20 method, UH=SCS, Weighted-Q, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs NY-Nelson 24-hr S1 100-yr Rainfall=6.27" Area (sf) CN Description 1,658 98 Paved parking, HSG A 1,658 100.00% Impervious Area NY-Nelson 24-hr S1 100-yr Rainfall=6.27"Post-Development Witt Nelson Printed 2/25/2026Prepared by The LA Group, PC Page 19HydroCAD® 10.20-4c s/n 00439 © 2024 HydroCAD Software Solutions LLC Tc Length Slope Velocity Capacity Description (min) (feet) (ft/ft) (ft/sec) (cfs) 6.0 Direct Entry, Summary for Subcatchment 13a: Subcat 13a Runoff = 0.11 cfs @ 12.04 hrs, Volume= 370 cf, Depth> 6.03" Routed to Pond 17P : Perf Header Pipe Runoff by SCS TR-20 method, UH=SCS, Weighted-Q, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs NY-Nelson 24-hr S1 100-yr Rainfall=6.27" Area (sf) CN Description 736 98 Paved parking, HSG A 736 100.00% Impervious Area Tc Length Slope Velocity Capacity Description (min) (feet) (ft/ft) (ft/sec) (cfs) 6.0 Direct Entry, Summary for Subcatchment 13b: Subcat 13b Runoff = 0.10 cfs @ 12.04 hrs, Volume= 313 cf, Depth> 6.03" Routed to Pond 17P : Perf Header Pipe Runoff by SCS TR-20 method, UH=SCS, Weighted-Q, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs NY-Nelson 24-hr S1 100-yr Rainfall=6.27" Area (sf) CN Description 622 98 Paved parking, HSG A 622 100.00% Impervious Area Tc Length Slope Velocity Capacity Description (min) (feet) (ft/ft) (ft/sec) (cfs) 6.0 Direct Entry, Summary for Subcatchment 13c: Subcat 13c Runoff = 0.07 cfs @ 12.04 hrs, Volume= 242 cf, Depth> 6.03" Routed to Pond 17P : Perf Header Pipe Runoff by SCS TR-20 method, UH=SCS, Weighted-Q, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs NY-Nelson 24-hr S1 100-yr Rainfall=6.27" Area (sf) CN Description 482 98 Paved parking, HSG A 482 100.00% Impervious Area NY-Nelson 24-hr S1 100-yr Rainfall=6.27"Post-Development Witt Nelson Printed 2/25/2026Prepared by The LA Group, PC Page 20HydroCAD® 10.20-4c s/n 00439 © 2024 HydroCAD Software Solutions LLC Tc Length Slope Velocity Capacity Description (min) (feet) (ft/ft) (ft/sec) (cfs) 6.0 Direct Entry, Summary for Subcatchment 13d: Subcat 13d Runoff = 0.14 cfs @ 12.04 hrs, Volume= 467 cf, Depth> 6.02" Routed to Pond 18P : CB-1 Runoff by SCS TR-20 method, UH=SCS, Weighted-Q, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs NY-Nelson 24-hr S1 100-yr Rainfall=6.27" Area (sf) CN Description 1 39 >75% Grass cover, Good, HSG A 930 98 Paved parking, HSG A 930 Weighted Average 1 0.09% Pervious Area 930 99.91% Impervious Area Tc Length Slope Velocity Capacity Description (min) (feet) (ft/ft) (ft/sec) (cfs) 6.0 Direct Entry, Summary for Subcatchment 13e: Subcat 13e Runoff = 0.16 cfs @ 12.04 hrs, Volume= 504 cf, Depth> 6.03" Routed to Pond 24P : YD-6 Runoff by SCS TR-20 method, UH=SCS, Weighted-Q, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs NY-Nelson 24-hr S1 100-yr Rainfall=6.27" Area (sf) CN Description 1,004 98 Paved parking, HSG A 1,004 100.00% Impervious Area Tc Length Slope Velocity Capacity Description (min) (feet) (ft/ft) (ft/sec) (cfs) 6.0 Direct Entry, Summary for Subcatchment 13f: Subcat 13f Runoff = 0.12 cfs @ 12.04 hrs, Volume= 396 cf, Depth> 3.90" Routed to Pond SMP-4A : Porous Pavement Runoff by SCS TR-20 method, UH=SCS, Weighted-Q, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs NY-Nelson 24-hr S1 100-yr Rainfall=6.27" NY-Nelson 24-hr S1 100-yr Rainfall=6.27"Post-Development Witt Nelson Printed 2/25/2026Prepared by The LA Group, PC Page 21HydroCAD® 10.20-4c s/n 00439 © 2024 HydroCAD Software Solutions LLC Area (sf) CN Description 470 39 >75% Grass cover, Good, HSG A 748 98 Paved parking, HSG A 1,218 Weighted Average 470 38.56% Pervious Area 748 61.44% Impervious Area Tc Length Slope Velocity Capacity Description (min) (feet) (ft/ft) (ft/sec) (cfs) 6.0 Direct Entry, Summary for Subcatchment 13g: Subcat 13g Runoff = 0.07 cfs @ 12.04 hrs, Volume= 217 cf, Depth> 4.66" Routed to Pond SMP-2A : Porous Pavers Runoff by SCS TR-20 method, UH=SCS, Weighted-Q, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs NY-Nelson 24-hr S1 100-yr Rainfall=6.27" Area (sf) CN Description 139 39 >75% Grass cover, Good, HSG A 420 98 Paved parking, HSG A 559 Weighted Average 139 24.85% Pervious Area 420 75.15% Impervious Area Tc Length Slope Velocity Capacity Description (min) (feet) (ft/ft) (ft/sec) (cfs) 6.0 Direct Entry, Summary for Subcatchment 14: Subcat 14 Runoff = 0.03 cfs @ 12.16 hrs, Volume= 283 cf, Depth> 0.67" Routed to Pond SMP-3B : Drywell Runoff by SCS TR-20 method, UH=SCS, Weighted-Q, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs NY-Nelson 24-hr S1 100-yr Rainfall=6.27" Area (sf) CN Description 4,943 39 >75% Grass cover, Good, HSG A 133 98 Paved parking, HSG A 5,077 Weighted Average 4,943 97.37% Pervious Area 133 2.63% Impervious Area Tc Length Slope Velocity Capacity Description (min) (feet) (ft/ft) (ft/sec) (cfs) 6.0 Direct Entry, NY-Nelson 24-hr S1 100-yr Rainfall=6.27"Post-Development Witt Nelson Printed 2/25/2026Prepared by The LA Group, PC Page 22HydroCAD® 10.20-4c s/n 00439 © 2024 HydroCAD Software Solutions LLC Summary for Subcatchment 15: Subcat 15 Runoff = 0.13 cfs @ 12.04 hrs, Volume= 490 cf, Depth> 2.17" Routed to Pond SMP-3A : Drywell Runoff by SCS TR-20 method, UH=SCS, Weighted-Q, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs NY-Nelson 24-hr S1 100-yr Rainfall=6.27" Area (sf) CN Description 1,904 39 >75% Grass cover, Good, HSG A 810 98 Paved parking, HSG A 2,714 Weighted Average 1,904 70.14% Pervious Area 810 29.86% Impervious Area Tc Length Slope Velocity Capacity Description (min) (feet) (ft/ft) (ft/sec) (cfs) 6.0 Direct Entry, Summary for Subcatchment 16: Subcat 16 Runoff = 0.31 cfs @ 12.04 hrs, Volume= 1,004 cf, Depth> 5.83" Routed to Pond SMP-2 : Porous Pavers Runoff by SCS TR-20 method, UH=SCS, Weighted-Q, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs NY-Nelson 24-hr S1 100-yr Rainfall=6.27" Area (sf) CN Description 76 39 >75% Grass cover, Good, HSG A 1,992 98 Paved parking, HSG A 2,068 Weighted Average 76 3.67% Pervious Area 1,992 96.33% Impervious Area Tc Length Slope Velocity Capacity Description (min) (feet) (ft/ft) (ft/sec) (cfs) 6.0 Direct Entry, Summary for Subcatchment 17: Subcat 17 Runoff = 0.15 cfs @ 12.04 hrs, Volume= 517 cf, Depth> 3.82" Routed to Pond SMP-3C : Drywell Runoff by SCS TR-20 method, UH=SCS, Weighted-Q, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs NY-Nelson 24-hr S1 100-yr Rainfall=6.27" NY-Nelson 24-hr S1 100-yr Rainfall=6.27"Post-Development Witt Nelson Printed 2/25/2026Prepared by The LA Group, PC Page 23HydroCAD® 10.20-4c s/n 00439 © 2024 HydroCAD Software Solutions LLC Area (sf) CN Description 653 39 >75% Grass cover, Good, HSG A 973 98 Paved parking, HSG A 1,626 Weighted Average 653 40.14% Pervious Area 973 59.86% Impervious Area Tc Length Slope Velocity Capacity Description (min) (feet) (ft/ft) (ft/sec) (cfs) 6.0 Direct Entry, Summary for Subcatchment 18: Subcat 18 Runoff = 0.12 cfs @ 12.05 hrs, Volume= 540 cf, Depth> 1.47" Routed to Pond 21P : YD-20 Runoff by SCS TR-20 method, UH=SCS, Weighted-Q, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs NY-Nelson 24-hr S1 100-yr Rainfall=6.27" Area (sf) CN Description 3,648 39 >75% Grass cover, Good, HSG A 758 98 Paved parking, HSG A 4,406 Weighted Average 3,648 82.79% Pervious Area 758 17.21% Impervious Area Tc Length Slope Velocity Capacity Description (min) (feet) (ft/ft) (ft/sec) (cfs) 6.0 Direct Entry, Summary for Subcatchment 19: Subcat 19 Runoff = 0.28 cfs @ 12.04 hrs, Volume= 952 cf, Depth> 3.45" Routed to Pond SMP-3D : Drywell Runoff by SCS TR-20 method, UH=SCS, Weighted-Q, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs NY-Nelson 24-hr S1 100-yr Rainfall=6.27" Area (sf) CN Description 1,546 39 >75% Grass cover, Good, HSG A 1,761 98 Paved parking, HSG A 3,307 Weighted Average 1,546 46.74% Pervious Area 1,761 53.26% Impervious Area Tc Length Slope Velocity Capacity Description (min) (feet) (ft/ft) (ft/sec) (cfs) 6.0 Direct Entry, NY-Nelson 24-hr S1 100-yr Rainfall=6.27"Post-Development Witt Nelson Printed 2/25/2026Prepared by The LA Group, PC Page 24HydroCAD® 10.20-4c s/n 00439 © 2024 HydroCAD Software Solutions LLC Summary for Subcatchment 19a: Subcat 19a Runoff = 0.03 cfs @ 12.04 hrs, Volume= 136 cf, Depth> 1.77" Routed to Pond SMP-3D : Drywell Runoff by SCS TR-20 method, UH=SCS, Weighted-Q, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs NY-Nelson 24-hr S1 100-yr Rainfall=6.27" Area (sf) CN Description 711 39 >75% Grass cover, Good, HSG A 209 98 Paved parking, HSG A 919 Weighted Average 711 77.28% Pervious Area 209 22.72% Impervious Area Tc Length Slope Velocity Capacity Description (min) (feet) (ft/ft) (ft/sec) (cfs) 6.0 Direct Entry, Summary for Subcatchment 19b: Subcat 19b Runoff = 0.36 cfs @ 12.04 hrs, Volume= 1,177 cf, Depth> 5.26" Routed to Pond SMP-4C : Porous Pavement Runoff by SCS TR-20 method, UH=SCS, Weighted-Q, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs NY-Nelson 24-hr S1 100-yr Rainfall=6.27" Area (sf) CN Description 376 39 >75% Grass cover, Good, HSG A 2,311 98 Paved parking, HSG A 2,686 Weighted Average 376 13.98% Pervious Area 2,311 86.02% Impervious Area Tc Length Slope Velocity Capacity Description (min) (feet) (ft/ft) (ft/sec) (cfs) 6.0 Direct Entry, Summary for Subcatchment 20: Subcat 20 Runoff = 0.20 cfs @ 12.04 hrs, Volume= 696 cf, Depth> 2.98" Routed to Pond 26P : YD-11 Runoff by SCS TR-20 method, UH=SCS, Weighted-Q, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs NY-Nelson 24-hr S1 100-yr Rainfall=6.27" NY-Nelson 24-hr S1 100-yr Rainfall=6.27"Post-Development Witt Nelson Printed 2/25/2026Prepared by The LA Group, PC Page 25HydroCAD® 10.20-4c s/n 00439 © 2024 HydroCAD Software Solutions LLC Area (sf) CN Description 1,555 39 >75% Grass cover, Good, HSG A 1,250 98 Paved parking, HSG A 2,805 Weighted Average 1,555 55.43% Pervious Area 1,250 44.57% Impervious Area Tc Length Slope Velocity Capacity Description (min) (feet) (ft/ft) (ft/sec) (cfs) 6.0 Direct Entry, Summary for Subcatchment 21: Subcat 21 Runoff = 0.13 cfs @ 12.04 hrs, Volume= 465 cf, Depth> 3.02" Routed to Pond SMP-3A : Drywell Runoff by SCS TR-20 method, UH=SCS, Weighted-Q, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs NY-Nelson 24-hr S1 100-yr Rainfall=6.27" Area (sf) CN Description 1,012 39 >75% Grass cover, Good, HSG A 838 98 Paved parking, HSG A 1,851 Weighted Average 1,012 54.70% Pervious Area 838 45.30% Impervious Area Tc Length Slope Velocity Capacity Description (min) (feet) (ft/ft) (ft/sec) (cfs) 6.0 Direct Entry, Summary for Subcatchment 22: Subcat 22 Runoff = 0.10 cfs @ 12.04 hrs, Volume= 337 cf, Depth> 3.44" Routed to Pond 12P : YD-8 Runoff by SCS TR-20 method, UH=SCS, Weighted-Q, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs NY-Nelson 24-hr S1 100-yr Rainfall=6.27" Area (sf) CN Description 554 39 >75% Grass cover, Good, HSG A 623 98 Paved parking, HSG A 1,178 Weighted Average 554 47.08% Pervious Area 623 52.92% Impervious Area Tc Length Slope Velocity Capacity Description (min) (feet) (ft/ft) (ft/sec) (cfs) 6.0 Direct Entry, NY-Nelson 24-hr S1 100-yr Rainfall=6.27"Post-Development Witt Nelson Printed 2/25/2026Prepared by The LA Group, PC Page 26HydroCAD® 10.20-4c s/n 00439 © 2024 HydroCAD Software Solutions LLC Summary for Subcatchment 23: Subcat 23 Runoff = 0.29 cfs @ 12.04 hrs, Volume= 1,044 cf, Depth> 2.94" Routed to Pond 4P : YD-4 Runoff by SCS TR-20 method, UH=SCS, Weighted-Q, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs NY-Nelson 24-hr S1 100-yr Rainfall=6.27" Area (sf) CN Description 2,387 39 >75% Grass cover, Good, HSG A 1,871 98 Paved parking, HSG A 4,258 Weighted Average 2,387 56.06% Pervious Area 1,871 43.94% Impervious Area Tc Length Slope Velocity Capacity Description (min) (feet) (ft/ft) (ft/sec) (cfs) 6.0 Direct Entry, Summary for Subcatchment 24: Subcat 24 Runoff = 1.31 cfs @ 12.04 hrs, Volume= 4,338 cf, Depth> 4.91" Routed to Pond SMP-2 : Porous Pavers Runoff by SCS TR-20 method, UH=SCS, Weighted-Q, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs NY-Nelson 24-hr S1 100-yr Rainfall=6.27" Area (sf) CN Description 2,148 39 >75% Grass cover, Good, HSG A 8,451 98 Paved parking, HSG A 10,599 Weighted Average 2,148 20.27% Pervious Area 8,451 79.73% Impervious Area Tc Length Slope Velocity Capacity Description (min) (feet) (ft/ft) (ft/sec) (cfs) 6.0 Direct Entry, Summary for Subcatchment 25: Subcat 25 Runoff = 0.22 cfs @ 12.04 hrs, Volume= 757 cf, Depth> 3.24" Routed to Pond 31P : YD-16 Runoff by SCS TR-20 method, UH=SCS, Weighted-Q, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs NY-Nelson 24-hr S1 100-yr Rainfall=6.27" NY-Nelson 24-hr S1 100-yr Rainfall=6.27"Post-Development Witt Nelson Printed 2/25/2026Prepared by The LA Group, PC Page 27HydroCAD® 10.20-4c s/n 00439 © 2024 HydroCAD Software Solutions LLC Area (sf) CN Description 1,419 39 >75% Grass cover, Good, HSG A 1,383 98 Paved parking, HSG A 2,802 Weighted Average 1,419 50.64% Pervious Area 1,383 49.36% Impervious Area Tc Length Slope Velocity Capacity Description (min) (feet) (ft/ft) (ft/sec) (cfs) 6.0 Direct Entry, Summary for Subcatchment 26: Subcat 26 Runoff = 0.07 cfs @ 12.04 hrs, Volume= 242 cf, Depth> 2.56" Routed to Pond 26P : YD-11 Runoff by SCS TR-20 method, UH=SCS, Weighted-Q, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs NY-Nelson 24-hr S1 100-yr Rainfall=6.27" Area (sf) CN Description 714 39 >75% Grass cover, Good, HSG A 420 98 Paved parking, HSG A 1,134 Weighted Average 714 62.93% Pervious Area 420 37.07% Impervious Area Tc Length Slope Velocity Capacity Description (min) (feet) (ft/ft) (ft/sec) (cfs) 6.0 Direct Entry, Summary for Subcatchment 27: Subcat 27 Runoff = 0.23 cfs @ 12.04 hrs, Volume= 765 cf, Depth> 3.96" Routed to Pond 24P : YD-6 Runoff by SCS TR-20 method, UH=SCS, Weighted-Q, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs NY-Nelson 24-hr S1 100-yr Rainfall=6.27" Area (sf) CN Description 870 39 >75% Grass cover, Good, HSG A 1,448 98 Paved parking, HSG A 2,319 Weighted Average 870 37.54% Pervious Area 1,448 62.46% Impervious Area Tc Length Slope Velocity Capacity Description (min) (feet) (ft/ft) (ft/sec) (cfs) 6.0 Direct Entry, NY-Nelson 24-hr S1 100-yr Rainfall=6.27"Post-Development Witt Nelson Printed 2/25/2026Prepared by The LA Group, PC Page 28HydroCAD® 10.20-4c s/n 00439 © 2024 HydroCAD Software Solutions LLC Summary for Subcatchment 28: Subcat 28 Runoff = 0.24 cfs @ 12.04 hrs, Volume= 788 cf, Depth> 4.99" Routed to Pond 18P : CB-1 Runoff by SCS TR-20 method, UH=SCS, Weighted-Q, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs NY-Nelson 24-hr S1 100-yr Rainfall=6.27" Area (sf) CN Description 356 39 >75% Grass cover, Good, HSG A 1,539 98 Paved parking, HSG A 1,895 Weighted Average 356 18.78% Pervious Area 1,539 81.22% Impervious Area Tc Length Slope Velocity Capacity Description (min) (feet) (ft/ft) (ft/sec) (cfs) 6.0 Direct Entry, Summary for Pond 1P: YD-19 Inflow Area = 450 sf,100.00% Impervious, Inflow Depth > 6.03" for 100-yr event Inflow = 0.07 cfs @ 12.04 hrs, Volume= 226 cf Outflow = 0.07 cfs @ 12.04 hrs, Volume= 226 cf, Atten= 0%, Lag= 0.0 min Primary = 0.07 cfs @ 12.04 hrs, Volume= 226 cf Routed to Pond 21P : YD-20 Routing by Dyn-Stor-Ind method, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs Peak Elev= 309.48' @ 12.17 hrs Device Routing Invert Outlet Devices #1 Primary 308.00'8.0" Round Culvert L= 20.0' Ke= 0.500 Inlet / Outlet Invert= 308.00' / 307.00' S= 0.0500 '/' Cc= 0.900 n= 0.012, Flow Area= 0.35 sf Primary OutFlow Max=0.00 cfs @ 12.04 hrs HW=308.28' TW=308.58' (Dynamic Tailwater) 1=Culvert ( Controls 0.00 cfs) Summary for Pond 3P: YD-13 Inflow Area = 1,091 sf, 99.98% Impervious, Inflow Depth > 6.03" for 100-yr event Inflow = 0.17 cfs @ 12.04 hrs, Volume= 548 cf Outflow = 0.17 cfs @ 12.04 hrs, Volume= 548 cf, Atten= 0%, Lag= 0.0 min Primary = 0.17 cfs @ 12.04 hrs, Volume= 548 cf Routed to Pond 26P : YD-11 Routing by Dyn-Stor-Ind method, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs Peak Elev= 308.75' @ 12.05 hrs Device Routing Invert Outlet Devices #1 Primary 308.50'8.0" Round Culvert L= 75.0' Ke= 0.500 NY-Nelson 24-hr S1 100-yr Rainfall=6.27"Post-Development Witt Nelson Printed 2/25/2026Prepared by The LA Group, PC Page 29HydroCAD® 10.20-4c s/n 00439 © 2024 HydroCAD Software Solutions LLC Inlet / Outlet Invert= 308.50' / 307.75' S= 0.0100 '/' Cc= 0.900 n= 0.012, Flow Area= 0.35 sf Primary OutFlow Max=0.16 cfs @ 12.04 hrs HW=308.74' TW=308.25' (Dynamic Tailwater) 1=Culvert (Outlet Controls 0.16 cfs @ 2.02 fps) Summary for Pond 4P: YD-4 Inflow Area = 5,737 sf, 58.39% Impervious, Inflow Depth > 3.74" for 100-yr event Inflow = 0.52 cfs @ 12.04 hrs, Volume= 1,786 cf Outflow = 0.52 cfs @ 12.04 hrs, Volume= 1,786 cf, Atten= 0%, Lag= 0.0 min Primary = 0.52 cfs @ 12.04 hrs, Volume= 1,786 cf Routed to Pond 9P : YD-3 Routing by Dyn-Stor-Ind method, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs Peak Elev= 308.38' @ 12.06 hrs Device Routing Invert Outlet Devices #1 Primary 307.88'8.0" Round Culvert L= 44.0' Ke= 0.500 Inlet / Outlet Invert= 307.88' / 307.44' S= 0.0100 '/' Cc= 0.900 n= 0.012, Flow Area= 0.35 sf Primary OutFlow Max=0.45 cfs @ 12.04 hrs HW=308.37' TW=308.08' (Dynamic Tailwater) 1=Culvert (Outlet Controls 0.45 cfs @ 2.33 fps) Summary for Pond 6P: YD-15 Inflow Area = 2,364 sf, 99.93% Impervious, Inflow Depth > 6.02" for 100-yr event Inflow = 0.37 cfs @ 12.04 hrs, Volume= 1,187 cf Outflow = 0.37 cfs @ 12.04 hrs, Volume= 1,187 cf, Atten= 0%, Lag= 0.0 min Primary = 0.37 cfs @ 12.04 hrs, Volume= 1,187 cf Routed to Pond 31P : YD-16 Routing by Dyn-Stor-Ind method, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs Peak Elev= 308.53' @ 12.07 hrs Device Routing Invert Outlet Devices #1 Primary 308.00'8.0" Round Culvert L= 20.0' Ke= 0.500 Inlet / Outlet Invert= 308.00' / 307.00' S= 0.0500 '/' Cc= 0.900 n= 0.012, Flow Area= 0.35 sf Primary OutFlow Max=0.27 cfs @ 12.04 hrs HW=308.51' TW=308.45' (Dynamic Tailwater) 1=Culvert (Outlet Controls 0.27 cfs @ 1.31 fps) Summary for Pond 9P: YD-3 Inflow Area = 8,519 sf, 71.96% Impervious, Inflow Depth > 4.48" for 100-yr event Inflow = 0.95 cfs @ 12.04 hrs, Volume= 3,183 cf Outflow = 0.95 cfs @ 12.04 hrs, Volume= 3,183 cf, Atten= 0%, Lag= 0.0 min Primary = 0.95 cfs @ 12.04 hrs, Volume= 3,183 cf Routed to Pond 29P : MH-1 NY-Nelson 24-hr S1 100-yr Rainfall=6.27"Post-Development Witt Nelson Printed 2/25/2026Prepared by The LA Group, PC Page 30HydroCAD® 10.20-4c s/n 00439 © 2024 HydroCAD Software Solutions LLC Routing by Dyn-Stor-Ind method, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs Peak Elev= 308.10' @ 12.04 hrs Device Routing Invert Outlet Devices #1 Primary 307.44'8.0" Round Culvert L= 34.0' Ke= 0.500 Inlet / Outlet Invert= 307.44' / 307.10' S= 0.0100 '/' Cc= 0.900 n= 0.012, Flow Area= 0.35 sf Primary OutFlow Max=0.93 cfs @ 12.04 hrs HW=308.08' TW=307.46' (Dynamic Tailwater) 1=Culvert (Barrel Controls 0.93 cfs @ 3.44 fps) Summary for Pond 12P: YD-8 Inflow Area = 1,795 sf, 69.11% Impervious, Inflow Depth > 4.33" for 100-yr event Inflow = 0.19 cfs @ 12.04 hrs, Volume= 647 cf Outflow = 0.19 cfs @ 12.04 hrs, Volume= 647 cf, Atten= 0%, Lag= 0.0 min Primary = 0.19 cfs @ 12.04 hrs, Volume= 647 cf Routed to Pond 24P : YD-6 Routing by Dyn-Stor-Ind method, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs Peak Elev= 307.79' @ 12.09 hrs Device Routing Invert Outlet Devices #1 Primary 307.48'8.0" Round Culvert L= 80.0' Ke= 0.500 Inlet / Outlet Invert= 307.48' / 306.68' S= 0.0100 '/' Cc= 0.900 n= 0.012, Flow Area= 0.35 sf Primary OutFlow Max=0.13 cfs @ 12.04 hrs HW=307.76' TW=307.57' (Dynamic Tailwater) 1=Culvert (Outlet Controls 0.13 cfs @ 1.32 fps) Summary for Pond 17P: Perf Header Pipe Inflow Area = 1,841 sf,100.00% Impervious, Inflow Depth > 6.03" for 100-yr event Inflow = 0.29 cfs @ 12.04 hrs, Volume= 924 cf Outflow = 0.29 cfs @ 12.04 hrs, Volume= 924 cf, Atten= 0%, Lag= 0.0 min Primary = 0.29 cfs @ 12.04 hrs, Volume= 924 cf Routed to Pond 18P : CB-1 Routing by Dyn-Stor-Ind method, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs Peak Elev= 308.76' @ 12.04 hrs Device Routing Invert Outlet Devices #1 Primary 308.50'12.0" Round Culvert L= 115.0' Ke= 0.500 Inlet / Outlet Invert= 308.50' / 307.35' S= 0.0100 '/' Cc= 0.900 n= 0.012, Flow Area= 0.79 sf Primary OutFlow Max=0.28 cfs @ 12.04 hrs HW=308.76' TW=307.66' (Dynamic Tailwater) 1=Culvert (Inlet Controls 0.28 cfs @ 1.73 fps) NY-Nelson 24-hr S1 100-yr Rainfall=6.27"Post-Development Witt Nelson Printed 2/25/2026Prepared by The LA Group, PC Page 31HydroCAD® 10.20-4c s/n 00439 © 2024 HydroCAD Software Solutions LLC Summary for Pond 18P: CB-1 Inflow Area = 7,553 sf, 78.85% Impervious, Inflow Depth > 4.86" for 100-yr event Inflow = 0.93 cfs @ 12.04 hrs, Volume= 3,061 cf Outflow = 0.93 cfs @ 12.04 hrs, Volume= 3,061 cf, Atten= 0%, Lag= 0.0 min Primary = 0.93 cfs @ 12.04 hrs, Volume= 3,061 cf Routed to Pond 29P : MH-1 Routing by Dyn-Stor-Ind method, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs Peak Elev= 307.69' @ 12.06 hrs Device Routing Invert Outlet Devices #1 Primary 307.02'12.0" Round Culvert L= 63.0' Ke= 0.500 Inlet / Outlet Invert= 307.02' / 306.39' S= 0.0100 '/' Cc= 0.900 n= 0.012, Flow Area= 0.79 sf Primary OutFlow Max=0.75 cfs @ 12.04 hrs HW=307.66' TW=307.46' (Dynamic Tailwater) 1=Culvert (Outlet Controls 0.75 cfs @ 2.00 fps) Summary for Pond 21P: YD-20 Inflow Area = 5,410 sf, 32.55% Impervious, Inflow Depth > 2.32" for 100-yr event Inflow = 0.28 cfs @ 12.04 hrs, Volume= 1,044 cf Outflow = 0.28 cfs @ 12.04 hrs, Volume= 1,044 cf, Atten= 0%, Lag= 0.0 min Primary = 0.28 cfs @ 12.04 hrs, Volume= 1,044 cf Routed to Pond SMP-3C : Drywell Routing by Dyn-Stor-Ind method, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs Peak Elev= 309.48' @ 12.12 hrs Device Routing Invert Outlet Devices #1 Primary 308.00'8.0" Round Culvert L= 20.0' Ke= 0.500 Inlet / Outlet Invert= 308.00' / 307.00' S= 0.0500 '/' Cc= 0.900 n= 0.012, Flow Area= 0.35 sf Primary OutFlow Max=0.00 cfs @ 12.04 hrs HW=308.61' TW=309.29' (Dynamic Tailwater) 1=Culvert ( Controls 0.00 cfs) Summary for Pond 23P: Perf Header Pipe Inflow Area = 2,888 sf, 57.03% Impervious, Inflow Depth > 3.66" for 100-yr event Inflow = 0.26 cfs @ 12.04 hrs, Volume= 881 cf Outflow = 0.26 cfs @ 12.04 hrs, Volume= 881 cf, Atten= 0%, Lag= 0.0 min Primary = 0.26 cfs @ 12.04 hrs, Volume= 881 cf Routed to Pond 18P : CB-1 Routing by Dyn-Stor-Ind method, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs Peak Elev= 309.03' @ 12.04 hrs Device Routing Invert Outlet Devices #1 Primary 308.75'8.0" Round Culvert L= 82.0' Ke= 0.500 NY-Nelson 24-hr S1 100-yr Rainfall=6.27"Post-Development Witt Nelson Printed 2/25/2026Prepared by The LA Group, PC Page 32HydroCAD® 10.20-4c s/n 00439 © 2024 HydroCAD Software Solutions LLC Inlet / Outlet Invert= 308.75' / 307.93' S= 0.0100 '/' Cc= 0.900 n= 0.012, Flow Area= 0.35 sf Primary OutFlow Max=0.25 cfs @ 12.04 hrs HW=309.03' TW=307.66' (Dynamic Tailwater) 1=Culvert (Inlet Controls 0.25 cfs @ 1.80 fps) Summary for Pond 24P: YD-6 Inflow Area = 14,865 sf, 75.15% Impervious, Inflow Depth > 4.66" for 100-yr event Inflow = 1.74 cfs @ 12.04 hrs, Volume= 5,771 cf Outflow = 1.74 cfs @ 12.04 hrs, Volume= 5,771 cf, Atten= 0%, Lag= 0.0 min Primary = 1.74 cfs @ 12.04 hrs, Volume= 5,771 cf Routed to Pond 29P : MH-1 Routing by Dyn-Stor-Ind method, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs Peak Elev= 307.64' @ 12.07 hrs Device Routing Invert Outlet Devices #1 Primary 305.90'12.0" Round Culvert L= 40.0' Ke= 0.500 Inlet / Outlet Invert= 305.90' / 305.70' S= 0.0050 '/' Cc= 0.900 n= 0.012, Flow Area= 0.79 sf Primary OutFlow Max=1.23 cfs @ 12.04 hrs HW=307.56' TW=307.46' (Dynamic Tailwater) 1=Culvert (Inlet Controls 1.23 cfs @ 1.56 fps) Summary for Pond 26P: YD-11 Inflow Area = 6,632 sf, 65.79% Impervious, Inflow Depth > 4.14" for 100-yr event Inflow = 0.68 cfs @ 12.04 hrs, Volume= 2,291 cf Outflow = 0.68 cfs @ 12.04 hrs, Volume= 2,291 cf, Atten= 0%, Lag= 0.0 min Primary = 0.68 cfs @ 12.04 hrs, Volume= 2,291 cf Routed to Pond 27P : YD-10 Routing by Dyn-Stor-Ind method, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs Peak Elev= 308.26' @ 12.04 hrs Device Routing Invert Outlet Devices #1 Primary 307.75'8.0" Round Culvert L= 42.0' Ke= 0.500 Inlet / Outlet Invert= 307.75' / 307.33' S= 0.0100 '/' Cc= 0.900 n= 0.012, Flow Area= 0.35 sf Primary OutFlow Max=0.66 cfs @ 12.04 hrs HW=308.25' TW=307.36' (Dynamic Tailwater) 1=Culvert (Barrel Controls 0.66 cfs @ 3.28 fps) Summary for Pond 27P: YD-10 Inflow Area = 7,522 sf, 69.83% Impervious, Inflow Depth > 4.37" for 100-yr event Inflow = 0.82 cfs @ 12.04 hrs, Volume= 2,737 cf Outflow = 0.82 cfs @ 12.04 hrs, Volume= 2,737 cf, Atten= 0%, Lag= 0.0 min Primary = 0.82 cfs @ 12.04 hrs, Volume= 2,737 cf Routed to Pond 24P : YD-6 NY-Nelson 24-hr S1 100-yr Rainfall=6.27"Post-Development Witt Nelson Printed 2/25/2026Prepared by The LA Group, PC Page 33HydroCAD® 10.20-4c s/n 00439 © 2024 HydroCAD Software Solutions LLC Routing by Dyn-Stor-Ind method, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs Peak Elev= 307.66' @ 12.12 hrs Device Routing Invert Outlet Devices #1 Primary 306.23'12.0" Round Culvert L= 47.0' Ke= 0.500 Inlet / Outlet Invert= 306.23' / 306.00' S= 0.0049 '/' Cc= 0.900 n= 0.012, Flow Area= 0.79 sf Primary OutFlow Max=0.00 cfs @ 12.04 hrs HW=307.36' TW=307.57' (Dynamic Tailwater) 1=Culvert ( Controls 0.00 cfs) Summary for Pond 29P: MH-1 Inflow Area = 30,937 sf, 75.17% Impervious, Inflow Depth > 4.66" for 100-yr event Inflow = 3.62 cfs @ 12.04 hrs, Volume= 12,016 cf Outflow = 3.62 cfs @ 12.04 hrs, Volume= 12,016 cf, Atten= 0%, Lag= 0.0 min Primary = 3.62 cfs @ 12.04 hrs, Volume= 12,016 cf Routed to Pond SMP-1 : Chambers Routing by Dyn-Stor-Ind method, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs Peak Elev= 307.48' @ 12.04 hrs Device Routing Invert Outlet Devices #1 Primary 306.56'18.0" Round Culvert L= 9.0' Ke= 0.500 Inlet / Outlet Invert= 306.56' / 306.25' S= 0.0344 '/' Cc= 0.900 n= 0.012, Flow Area= 1.77 sf Primary OutFlow Max=3.52 cfs @ 12.04 hrs HW=307.46' TW=304.30' (Dynamic Tailwater) 1=Culvert (Barrel Controls 3.52 cfs @ 4.56 fps) Summary for Pond 31P: YD-16 Inflow Area = 5,167 sf, 72.50% Impervious, Inflow Depth > 4.51" for 100-yr event Inflow = 0.58 cfs @ 12.04 hrs, Volume= 1,943 cf Outflow = 0.58 cfs @ 12.04 hrs, Volume= 1,943 cf, Atten= 0%, Lag= 0.0 min Primary = 0.58 cfs @ 12.04 hrs, Volume= 1,943 cf Routed to Pond SMP-2 : Porous Pavers Routing by Dyn-Stor-Ind method, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs Peak Elev= 308.45' @ 12.05 hrs Device Routing Invert Outlet Devices #1 Primary 308.00'8.0" Round Culvert L= 20.0' Ke= 0.500 Inlet / Outlet Invert= 308.00' / 307.00' S= 0.0500 '/' Cc= 0.900 n= 0.012, Flow Area= 0.35 sf Primary OutFlow Max=0.53 cfs @ 12.04 hrs HW=308.45' TW=308.11' (Dynamic Tailwater) 1=Culvert (Outlet Controls 0.53 cfs @ 3.02 fps) NY-Nelson 24-hr S1 100-yr Rainfall=6.27"Post-Development Witt Nelson Printed 2/25/2026Prepared by The LA Group, PC Page 34HydroCAD® 10.20-4c s/n 00439 © 2024 HydroCAD Software Solutions LLC Summary for Pond 33P: YD-18 Inflow Area = 554 sf, 99.78% Impervious, Inflow Depth > 6.01" for 100-yr event Inflow = 0.09 cfs @ 12.04 hrs, Volume= 278 cf Outflow = 0.09 cfs @ 12.04 hrs, Volume= 278 cf, Atten= 0%, Lag= 0.0 min Primary = 0.09 cfs @ 12.04 hrs, Volume= 278 cf Routed to Pond 21P : YD-20 Routing by Dyn-Stor-Ind method, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs Peak Elev= 309.48' @ 12.17 hrs Device Routing Invert Outlet Devices #1 Primary 308.00'8.0" Round Culvert L= 20.0' Ke= 0.500 Inlet / Outlet Invert= 308.00' / 307.00' S= 0.0500 '/' Cc= 0.900 n= 0.012, Flow Area= 0.35 sf Primary OutFlow Max=0.00 cfs @ 12.04 hrs HW=308.29' TW=308.58' (Dynamic Tailwater) 1=Culvert ( Controls 0.00 cfs) Summary for Pond 34P: YD-21 Inflow Area = 2,224 sf, 99.73% Impervious, Inflow Depth > 6.01" for 100-yr event Inflow = 0.34 cfs @ 12.04 hrs, Volume= 1,114 cf Outflow = 0.34 cfs @ 12.04 hrs, Volume= 1,114 cf, Atten= 0%, Lag= 0.0 min Primary = 0.34 cfs @ 12.04 hrs, Volume= 1,114 cf Routed to Pond SMP-3C : Drywell Routing by Dyn-Stor-Ind method, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs Peak Elev= 309.48' @ 12.12 hrs Device Routing Invert Outlet Devices #1 Primary 308.00'8.0" Round Culvert L= 20.0' Ke= 0.500 Inlet / Outlet Invert= 308.00' / 307.00' S= 0.0500 '/' Cc= 0.900 n= 0.012, Flow Area= 0.35 sf Primary OutFlow Max=0.00 cfs @ 12.04 hrs HW=308.60' TW=309.24' (Dynamic Tailwater) 1=Culvert ( Controls 0.00 cfs) Summary for Pond 35P: YD-22 Inflow Area = 863 sf,100.00% Impervious, Inflow Depth > 6.03" for 100-yr event Inflow = 0.13 cfs @ 12.04 hrs, Volume= 433 cf Outflow = 0.13 cfs @ 12.04 hrs, Volume= 433 cf, Atten= 0%, Lag= 0.0 min Primary = 0.13 cfs @ 12.04 hrs, Volume= 433 cf Routed to Pond SMP-3B : Drywell Routing by Dyn-Stor-Ind method, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs Peak Elev= 308.21' @ 12.04 hrs Device Routing Invert Outlet Devices #1 Primary 308.00'8.0" Round Culvert L= 65.0' Ke= 0.500 NY-Nelson 24-hr S1 100-yr Rainfall=6.27"Post-Development Witt Nelson Printed 2/25/2026Prepared by The LA Group, PC Page 35HydroCAD® 10.20-4c s/n 00439 © 2024 HydroCAD Software Solutions LLC Inlet / Outlet Invert= 308.00' / 307.50' S= 0.0077 '/' Cc= 0.900 n= 0.012, Flow Area= 0.35 sf Primary OutFlow Max=0.13 cfs @ 12.04 hrs HW=308.21' TW=303.85' (Dynamic Tailwater) 1=Culvert (Barrel Controls 0.13 cfs @ 2.10 fps) Summary for Pond SMP-1: Chambers Inflow Area = 30,937 sf, 75.17% Impervious, Inflow Depth > 4.66" for 100-yr event Inflow = 3.62 cfs @ 12.04 hrs, Volume= 12,016 cf Outflow = 1.53 cfs @ 11.95 hrs, Volume= 12,073 cf, Atten= 58%, Lag= 0.0 min Discarded = 1.53 cfs @ 11.95 hrs, Volume= 12,073 cf Routing by Dyn-Stor-Ind method, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs Peak Elev= 304.97' @ 12.22 hrs Surf.Area= 1,098 sf Storage= 1,064 cf Plug-Flow detention time= (not calculated: outflow precedes inflow) Center-of-Mass det. time= 3.0 min ( 752.7 - 749.7 ) Volume Invert Avail.Storage Storage Description #1A 303.50' 1,070 cf 20.50'W x 53.58'L x 3.75'H Field A 4,119 cf Overall - 1,444 cf Embedded = 2,675 cf x 40.0% Voids #2A 304.00' 1,444 cf ADS_StormTech SC-800 +Cap x 28 Inside #1 Effective Size= 45.0"W x 33.0"H => 7.11 sf x 7.12'L = 50.6 cf Overall Size= 51.0"W x 33.0"H x 7.55'L with 0.43' Overlap 28 Chambers in 4 Rows Cap Storage= 3.4 cf x 2 x 4 rows = 27.4 cf 2,514 cf Total Available Storage Storage Group A created with Chamber Wizard Device Routing Invert Outlet Devices #1 Discarded 303.50'60.000 in/hr Exfiltration over Surface area Discarded OutFlow Max=1.53 cfs @ 11.95 hrs HW=303.58' (Free Discharge) 1=Exfiltration (Exfiltration Controls 1.53 cfs) Summary for Pond SMP-2: Porous Pavers Inflow Area = 19,479 sf, 81.28% Impervious, Inflow Depth > 5.31" for 100-yr event Inflow = 3.22 cfs @ 12.05 hrs, Volume= 8,619 cf Outflow = 1.05 cfs @ 12.00 hrs, Volume= 8,661 cf, Atten= 67%, Lag= 0.0 min Discarded = 1.05 cfs @ 12.00 hrs, Volume= 8,661 cf Routing by Dyn-Stor-Ind method, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs Peak Elev= 308.29' @ 12.27 hrs Surf.Area= 9,087 sf Storage= 1,054 cf Plug-Flow detention time= (not calculated: outflow precedes inflow) Center-of-Mass det. time= 4.3 min ( 751.3 - 747.0 ) NY-Nelson 24-hr S1 100-yr Rainfall=6.27"Post-Development Witt Nelson Printed 2/25/2026Prepared by The LA Group, PC Page 36HydroCAD® 10.20-4c s/n 00439 © 2024 HydroCAD Software Solutions LLC Volume Invert Avail.Storage Storage Description #1 308.00' 7,270 cf Custom Stage Data (Prismatic) Listed below (Recalc) Elevation Surf.Area Voids Inc.Store Cum.Store (feet) (sq-ft) (%) (cubic-feet) (cubic-feet) 308.00 9,087 0.0 0 0 310.00 9,087 40.0 7,270 7,270 Device Routing Invert Outlet Devices #1 Discarded 308.00'5.000 in/hr Exfiltration over Surface area Discarded OutFlow Max=1.05 cfs @ 12.00 hrs HW=308.04' (Free Discharge) 1=Exfiltration (Exfiltration Controls 1.05 cfs) Summary for Pond SMP-2A: Porous Pavers Inflow Area = 559 sf, 75.15% Impervious, Inflow Depth > 4.66" for 100-yr event Inflow = 0.07 cfs @ 12.04 hrs, Volume= 217 cf Outflow = 0.07 cfs @ 12.04 hrs, Volume= 217 cf, Atten= 0%, Lag= 0.0 min Discarded = 0.07 cfs @ 12.04 hrs, Volume= 217 cf Routing by Dyn-Stor-Ind method, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs Peak Elev= 0.00' @ 12.05 hrs Surf.Area= 9,087 sf Storage= 0 cf Plug-Flow detention time= (not calculated: outflow precedes inflow) Center-of-Mass det. time= 0.0 min ( 749.7 - 749.7 ) Volume Invert Avail.Storage Storage Description #1 0.00' 7,270 cf Custom Stage Data (Prismatic) Listed below (Recalc) Elevation Surf.Area Voids Inc.Store Cum.Store (feet) (sq-ft) (%) (cubic-feet) (cubic-feet) 0.00 9,087 0.0 0 0 2.00 9,087 40.0 7,270 7,270 Device Routing Invert Outlet Devices #1 Discarded 0.00'5.000 in/hr Exfiltration over Surface area Discarded OutFlow Max=1.05 cfs @ 12.04 hrs HW=0.00' (Free Discharge) 1=Exfiltration (Exfiltration Controls 1.05 cfs) Summary for Pond SMP-3A: Drywell Inflow Area = 5,244 sf, 44.40% Impervious, Inflow Depth > 2.97" for 100-yr event Inflow = 0.37 cfs @ 12.04 hrs, Volume= 1,297 cf Outflow = 0.21 cfs @ 12.00 hrs, Volume= 1,302 cf, Atten= 43%, Lag= 0.0 min Discarded = 0.21 cfs @ 12.00 hrs, Volume= 1,302 cf Routing by Dyn-Stor-Ind method, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs NY-Nelson 24-hr S1 100-yr Rainfall=6.27"Post-Development Witt Nelson Printed 2/25/2026Prepared by The LA Group, PC Page 37HydroCAD® 10.20-4c s/n 00439 © 2024 HydroCAD Software Solutions LLC Peak Elev= 304.51' @ 12.16 hrs Surf.Area= 151 sf Storage= 62 cf Plug-Flow detention time= (not calculated: outflow precedes inflow) Center-of-Mass det. time= 1.2 min ( 766.2 - 765.0 ) Volume Invert Avail.Storage Storage Description #1 304.50' 509 cf 6.00'D x 6.00'H Vertical Cone/Cylinder x 3 Inside #2 #2 303.50' 219 cf 8.00'D x 7.00'H Vertical Cone/Cylinder x 3 1,056 cf Overall - 509 cf Embedded = 547 cf x 40.0% Voids 728 cf Total Available Storage Device Routing Invert Outlet Devices #1 Discarded 303.50'60.000 in/hr Exfiltration over Surface area Discarded OutFlow Max=0.21 cfs @ 12.00 hrs HW=303.67' (Free Discharge) 1=Exfiltration (Exfiltration Controls 0.21 cfs) Summary for Pond SMP-3B: Drywell Inflow Area = 6,316 sf, 21.74% Impervious, Inflow Depth > 1.72" for 100-yr event Inflow = 0.22 cfs @ 12.04 hrs, Volume= 906 cf Outflow = 0.14 cfs @ 12.00 hrs, Volume= 907 cf, Atten= 37%, Lag= 0.0 min Discarded = 0.14 cfs @ 12.00 hrs, Volume= 907 cf Routing by Dyn-Stor-Ind method, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs Peak Elev= 304.25' @ 12.16 hrs Surf.Area= 101 sf Storage= 30 cf Plug-Flow detention time= (not calculated: outflow precedes inflow) Center-of-Mass det. time= 1.0 min ( 796.4 - 795.4 ) Volume Invert Avail.Storage Storage Description #1 304.50' 339 cf 6.00'D x 6.00'H Vertical Cone/Cylinder x 2 Inside #2 #2 303.50' 146 cf 8.00'D x 7.00'H Vertical Cone/Cylinder x 2 704 cf Overall - 339 cf Embedded = 364 cf x 40.0% Voids 485 cf Total Available Storage Device Routing Invert Outlet Devices #1 Discarded 303.50'60.000 in/hr Exfiltration over Surface area Discarded OutFlow Max=0.14 cfs @ 12.00 hrs HW=303.61' (Free Discharge) 1=Exfiltration (Exfiltration Controls 0.14 cfs) Summary for Pond SMP-3C: Drywell Inflow Area = 9,259 sf, 53.48% Impervious, Inflow Depth > 3.47" for 100-yr event Inflow = 0.77 cfs @ 12.04 hrs, Volume= 2,675 cf Outflow = 0.90 cfs @ 12.06 hrs, Volume= 2,676 cf, Atten= 0%, Lag= 1.2 min Discarded = 0.11 cfs @ 11.60 hrs, Volume= 2,169 cf Secondary = 0.80 cfs @ 12.06 hrs, Volume= 507 cf Routed to Pond SMP-2 : Porous Pavers NY-Nelson 24-hr S1 100-yr Rainfall=6.27"Post-Development Witt Nelson Printed 2/25/2026Prepared by The LA Group, PC Page 38HydroCAD® 10.20-4c s/n 00439 © 2024 HydroCAD Software Solutions LLC Routing by Dyn-Stor-Ind method, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs Peak Elev= 309.46' @ 12.07 hrs Surf.Area= 77 sf Storage= 279 cf Plug-Flow detention time= (not calculated: outflow precedes inflow) Center-of-Mass det. time= 8.5 min ( 767.4 - 758.9 ) Volume Invert Avail.Storage Storage Description #1 304.90' 118 cf 5.00'D x 6.00'H Vertical Cone/Cylinder Inside #2 #2 303.90' 61 cf 7.00'D x 7.00'H Vertical Cone/Cylinder 269 cf Overall - 118 cf Embedded = 152 cf x 40.0% Voids 178 cf x 2.00 = 357 cf Total Available Storage Device Routing Invert Outlet Devices #1 Discarded 303.90'60.000 in/hr Exfiltration over Surface area #2 Secondary 308.90'12.0" Round Culvert L= 10.0' Ke= 0.500 Inlet / Outlet Invert= 308.90' / 308.80' S= 0.0100 '/' Cc= 0.900 n= 0.012, Flow Area= 0.79 sf Discarded OutFlow Max=0.11 cfs @ 11.60 hrs HW=304.00' (Free Discharge) 1=Exfiltration (Exfiltration Controls 0.11 cfs) Secondary OutFlow Max=0.70 cfs @ 12.06 hrs HW=309.38' TW=308.14' (Dynamic Tailwater) 2=Culvert (Barrel Controls 0.70 cfs @ 2.76 fps) Summary for Pond SMP-3D: Drywell Inflow Area = 4,227 sf, 46.61% Impervious, Inflow Depth > 3.09" for 100-yr event Inflow = 0.31 cfs @ 12.04 hrs, Volume= 1,088 cf Outflow = 0.14 cfs @ 12.00 hrs, Volume= 1,094 cf, Atten= 55%, Lag= 0.0 min Discarded = 0.14 cfs @ 12.00 hrs, Volume= 1,094 cf Routing by Dyn-Stor-Ind method, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs Peak Elev= 305.58' @ 12.21 hrs Surf.Area= 101 sf Storage= 83 cf Plug-Flow detention time= (not calculated: outflow precedes inflow) Center-of-Mass det. time= 2.0 min ( 765.3 - 763.3 ) Volume Invert Avail.Storage Storage Description #1 305.00' 339 cf 6.00'D x 6.00'H Vertical Cone/Cylinder x 2 Inside #2 #2 304.00' 146 cf 8.00'D x 7.00'H Vertical Cone/Cylinder x 2 704 cf Overall - 339 cf Embedded = 364 cf x 40.0% Voids 485 cf Total Available Storage Device Routing Invert Outlet Devices #1 Discarded 304.00'60.000 in/hr Exfiltration over Surface area Discarded OutFlow Max=0.14 cfs @ 12.00 hrs HW=304.39' (Free Discharge) 1=Exfiltration (Exfiltration Controls 0.14 cfs) NY-Nelson 24-hr S1 100-yr Rainfall=6.27"Post-Development Witt Nelson Printed 2/25/2026Prepared by The LA Group, PC Page 39HydroCAD® 10.20-4c s/n 00439 © 2024 HydroCAD Software Solutions LLC Summary for Pond SMP-4A: Porous Pavement Inflow Area = 1,218 sf, 61.44% Impervious, Inflow Depth > 3.90" for 100-yr event Inflow = 0.12 cfs @ 12.04 hrs, Volume= 396 cf Outflow = 0.08 cfs @ 12.05 hrs, Volume= 399 cf, Atten= 36%, Lag= 0.6 min Discarded = 0.08 cfs @ 12.05 hrs, Volume= 399 cf Routing by Dyn-Stor-Ind method, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs Peak Elev= 308.05' @ 12.13 hrs Surf.Area= 650 sf Storage= 14 cf Plug-Flow detention time= (not calculated: outflow precedes inflow) Center-of-Mass det. time= 0.9 min ( 755.8 - 754.9 ) Volume Invert Avail.Storage Storage Description #1 308.00' 520 cf Custom Stage Data (Prismatic) Listed below (Recalc) Elevation Surf.Area Voids Inc.Store Cum.Store (feet) (sq-ft) (%) (cubic-feet) (cubic-feet) 308.00 650 0.0 0 0 310.00 650 40.0 520 520 Device Routing Invert Outlet Devices #1 Discarded 308.00'5.000 in/hr Exfiltration over Surface area Discarded OutFlow Max=0.08 cfs @ 12.05 hrs HW=308.03' (Free Discharge) 1=Exfiltration (Exfiltration Controls 0.08 cfs) Summary for Pond SMP-4B: Porous Pavement Inflow Area = 3,594 sf, 98.17% Impervious, Inflow Depth > 5.93" for 100-yr event Inflow = 0.55 cfs @ 12.04 hrs, Volume= 1,775 cf Outflow = 0.24 cfs @ 12.00 hrs, Volume= 1,788 cf, Atten= 57%, Lag= 0.0 min Discarded = 0.24 cfs @ 12.00 hrs, Volume= 1,788 cf Routing by Dyn-Stor-Ind method, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs Peak Elev= 308.69' @ 12.21 hrs Surf.Area= 2,050 sf Storage= 153 cf Plug-Flow detention time= (not calculated: outflow precedes inflow) Center-of-Mass det. time= 2.4 min ( 746.4 - 744.0 ) Volume Invert Avail.Storage Storage Description #1 308.50' 1,640 cf Custom Stage Data (Prismatic) Listed below (Recalc) Elevation Surf.Area Voids Inc.Store Cum.Store (feet) (sq-ft) (%) (cubic-feet) (cubic-feet) 308.50 2,050 0.0 0 0 310.50 2,050 40.0 1,640 1,640 Device Routing Invert Outlet Devices #1 Discarded 308.50'5.000 in/hr Exfiltration over Surface area NY-Nelson 24-hr S1 100-yr Rainfall=6.27"Post-Development Witt Nelson Printed 2/25/2026Prepared by The LA Group, PC Page 40HydroCAD® 10.20-4c s/n 00439 © 2024 HydroCAD Software Solutions LLC Discarded OutFlow Max=0.24 cfs @ 12.00 hrs HW=308.54' (Free Discharge) 1=Exfiltration (Exfiltration Controls 0.24 cfs) Summary for Pond SMP-4C: Porous Pavement Inflow Area = 2,686 sf, 86.02% Impervious, Inflow Depth > 5.26" for 100-yr event Inflow = 0.36 cfs @ 12.04 hrs, Volume= 1,177 cf Outflow = 0.18 cfs @ 12.00 hrs, Volume= 1,181 cf, Atten= 50%, Lag= 0.0 min Discarded = 0.18 cfs @ 12.00 hrs, Volume= 1,181 cf Routing by Dyn-Stor-Ind method, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs Peak Elev= 308.63' @ 12.18 hrs Surf.Area= 1,540 sf Storage= 79 cf Plug-Flow detention time= (not calculated: outflow precedes inflow) Center-of-Mass det. time= 1.8 min ( 748.5 - 746.7 ) Volume Invert Avail.Storage Storage Description #1 308.50' 1,232 cf Custom Stage Data (Prismatic) Listed below (Recalc) Elevation Surf.Area Voids Inc.Store Cum.Store (feet) (sq-ft) (%) (cubic-feet) (cubic-feet) 308.50 1,540 0.0 0 0 310.50 1,540 40.0 1,232 1,232 Device Routing Invert Outlet Devices #1 Discarded 308.50'5.000 in/hr Exfiltration over Surface area Discarded OutFlow Max=0.18 cfs @ 12.00 hrs HW=308.52' (Free Discharge) 1=Exfiltration (Exfiltration Controls 0.18 cfs) Summary for Link AP-1: AP-1 Inflow Area = 24,700 sf, 26.81% Impervious, Inflow Depth > 2.00" for 100-yr event Inflow = 0.89 cfs @ 12.11 hrs, Volume= 4,110 cf Primary = 0.89 cfs @ 12.11 hrs, Volume= 4,110 cf, Atten= 0%, Lag= 0.0 min Primary outflow = Inflow, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs Summary for Link AP-2: AP-2 Inflow Area = 5,682 sf, 72.48% Impervious, Inflow Depth > 4.51" for 100-yr event Inflow = 0.64 cfs @ 12.04 hrs, Volume= 2,137 cf Primary = 0.64 cfs @ 12.04 hrs, Volume= 2,137 cf, Atten= 0%, Lag= 0.0 min Primary outflow = Inflow, Time Span= 0.00-24.00 hrs, dt= 0.05 hrs Appendix D Storm Data Stormwater Practice Sizing Water Quality Volume Calculation 2/25/2026 WQv = [(P)(Rv)(A)]/12 Where: Rv = 0.05 + 0.009(I) I = impervious cover in percent P = 90% rainfall (see Figure 4.1 in NYS Stormwater Management Design Manual) A = Area in acres Required WQv New Impervious % Impervious 100.00% Rv 0.95 90% Rainfall 1.15 Area in Square Feet 39,627 WQv Calculated =3608 ft3 0.083 ac-ft Existing Disturbed Impervious (25% Treatment) % Impervious 100.00% Rv 0.95 90% Rainfall 1.15 Area in Square Feet 16,875 WQv Calculated =1536 ft3 0.035 ac-ft WQv Required (25%)=384 ft3 0.009 ac-ft Total = 3992 ft4 0.092 ac-ft Provided WQv SMP-1: Underground Infiltration Chambers % Impervious 75.17% Rv 0.73 90% Rainfall 1.15 Area in Square Feet 30,937 WQv Calculated =2154 ft3 0.049 ac-ft SMP-2: Porous Pavers % Impervious 81.28% Rv 0.78 90% Rainfall 1.15 Area in Square Feet 19,479 WQv Calculated =1459 ft3 0.033 ac-ft SMP-2A: Porous Pavers % Impervious 75.15% Rv 0.73 90% Rainfall 1.15 Area in Square Feet 559 WQv Calculated =39 ft3 0.001 ac-ft JW Hemmingway PUDJob Name SMP-3A: Drywell % Impervious 44.40% Rv 0.45 90% Rainfall 1.15 Area in Square Feet 5,244 WQv Calculated =226 ft3 0.005 ac-ft SMP-3B: Drywell % Impervious 21.74% Rv 0.25 90% Rainfall 1.15 Area in Square Feet 6,316 WQv Calculated =149 ft3 0.003 ac-ft SMP-3C: Drywell % Impervious 53.48% Rv 0.53 90% Rainfall 1.15 Area in Square Feet 9,259 WQv Calculated =471 ft3 0.011 ac-ft SMP-3D: Drywell % Impervious 46.61% Rv 0.47 90% Rainfall 1.15 Area in Square Feet 4,227 WQv Calculated =190 ft3 0.004 ac-ft SMP-4A: Porous Pavement % Impervious 61.44% Rv 0.60 90% Rainfall 1.15 Area in Square Feet 1,218 WQv Calculated =70 ft3 0.002 ac-ft SMP-4B: Porous Pavement % Impervious 98.17% Rv 0.93 90% Rainfall 1.15 Area in Square Feet 3,594 WQv Calculated =322 ft3 0.007 ac-ft SMP-4C: Porous Pavement % Impervious 86.02% Rv 0.82 90% Rainfall 1.15 Area in Square Feet 2,686 WQv Calculated =212 ft3 0.005 ac-ft 0.120 ac-ftTotal WQv Provided = Appendix E Resource Mapping and Soils Data United States Department of Agriculture A product of the National Cooperative Soil Survey, a joint effort of the United States Department of Agriculture and other Federal agencies, State agencies including the Agricultural Experiment Stations, and local participants Custom Soil Resource Report for Saratoga County, New York Natural Resources Conservation Service August 5, 2025 Preface Soil surveys contain information that affects land use planning in survey areas. They highlight soil limitations that affect various land uses and provide information about the properties of the soils in the survey areas. Soil surveys are designed for many different users, including farmers, ranchers, foresters, agronomists, urban planners, community officials, engineers, developers, builders, and home buyers. Also, conservationists, teachers, students, and specialists in recreation, waste disposal, and pollution control can use the surveys to help them understand, protect, or enhance the environment. Various land use regulations of Federal, State, and local governments may impose special restrictions on land use or land treatment. Soil surveys identify soil properties that are used in making various land use or land treatment decisions. The information is intended to help the land users identify and reduce the effects of soil limitations on various land uses. The landowner or user is responsible for identifying and complying with existing laws and regulations. Although soil survey information can be used for general farm, local, and wider area planning, onsite investigation is needed to supplement this information in some cases. Examples include soil quality assessments (http://www.nrcs.usda.gov/wps/ portal/nrcs/main/soils/health/) and certain conservation and engineering applications. For more detailed information, contact your local USDA Service Center (https://offices.sc.egov.usda.gov/locator/app?agency=nrcs) or your NRCS State Soil Scientist (http://www.nrcs.usda.gov/wps/portal/nrcs/detail/soils/contactus/? cid=nrcs142p2_053951). Great differences in soil properties can occur within short distances. Some soils are seasonally wet or subject to flooding. Some are too unstable to be used as a foundation for buildings or roads. Clayey or wet soils are poorly suited to use as septic tank absorption fields. A high water table makes a soil poorly suited to basements or underground installations. The National Cooperative Soil Survey is a joint effort of the United States Department of Agriculture and other Federal agencies, State agencies including the Agricultural Experiment Stations, and local agencies. The Natural Resources Conservation Service (NRCS) has leadership for the Federal part of the National Cooperative Soil Survey. Information about soils is updated periodically. Updated information is available through the NRCS Web Soil Survey, the site for official soil survey information. The U.S. Department of Agriculture (USDA) prohibits discrimination in all its programs and activities on the basis of race, color, national origin, age, disability, and where applicable, sex, marital status, familial status, parental status, religion, sexual orientation, genetic information, political beliefs, reprisal, or because all or a part of an individual's income is derived from any public assistance program. (Not all prohibited bases apply to all programs.) Persons with disabilities who require 2 alternative means for communication of program information (Braille, large print, audiotape, etc.) should contact USDA's TARGET Center at (202) 720-2600 (voice and TDD). To file a complaint of discrimination, write to USDA, Director, Office of Civil Rights, 1400 Independence Avenue, S.W., Washington, D.C. 20250-9410 or call (800) 795-3272 (voice) or (202) 720-6382 (TDD). USDA is an equal opportunity provider and employer. 3 Contents Preface....................................................................................................................2 Soil Map..................................................................................................................5 Soil Map................................................................................................................6 Legend..................................................................................................................7 Map Unit Legend..................................................................................................8 Map Unit Descriptions..........................................................................................8 Saratoga County, New York............................................................................10 WnA—Windsor loamy sand, 0 to 3 percent slopes.....................................10 References............................................................................................................12 4 Soil Map The soil map section includes the soil map for the defined area of interest, a list of soil map units on the map and extent of each map unit, and cartographic symbols displayed on the map. Also presented are various metadata about data used to produce the map, and a description of each soil map unit. 5 6 Custom Soil Resource Report Soil Map 47 6 9 4 4 0 47 6 9 4 6 0 47 6 9 4 8 0 47 6 9 5 0 0 47 6 9 5 2 0 47 6 9 5 4 0 47 6 9 5 6 0 47 6 9 5 8 0 47 6 9 6 0 0 47 6 9 4 4 0 47 6 9 4 6 0 47 6 9 4 8 0 47 6 9 5 0 0 47 6 9 5 2 0 47 6 9 5 4 0 47 6 9 5 6 0 47 6 9 5 8 0 47 6 9 6 0 0 598340 598360 598380 598400 598420 598440 598460 598340 598360 598380 598400 598420 598440 598460 43° 4' 22'' N 73 ° 4 7 ' 3 1 ' ' W 43° 4' 22'' N 73 ° 4 7 ' 2 5 ' ' W 43° 4' 16'' N 73 ° 4 7 ' 3 1 ' ' W 43° 4' 16'' N 73 ° 4 7 ' 2 5 ' ' W N Map projection: Web Mercator Corner coordinates: WGS84 Edge tics: UTM Zone 18N WGS84 0 40 80 160 240 Feet 0 10 20 40 60 Meters Map Scale: 1:868 if printed on A portrait (8.5" x 11") sheet. Soil Map may not be valid at this scale. MAP LEGEND MAP INFORMATION Area of Interest (AOI) Area of Interest (AOI) Soils Soil Map Unit Polygons Soil Map Unit Lines Soil Map Unit Points Special Point Features Blowout Borrow Pit Clay Spot Closed Depression Gravel Pit Gravelly Spot Landfill Lava Flow Marsh or swamp Mine or Quarry Miscellaneous Water Perennial Water Rock Outcrop Saline Spot Sandy Spot Severely Eroded Spot Sinkhole Slide or Slip Sodic Spot Spoil Area Stony Spot Very Stony Spot Wet Spot Other Special Line Features Water Features Streams and Canals Transportation Rails Interstate Highways US Routes Major Roads Local Roads Background Aerial Photography The soil surveys that comprise your AOI were mapped at 1:24,000. Warning: Soil Map may not be valid at this scale. Enlargement of maps beyond the scale of mapping can cause misunderstanding of the detail of mapping and accuracy of soil line placement. The maps do not show the small areas of contrasting soils that could have been shown at a more detailed scale. Please rely on the bar scale on each map sheet for map measurements. Source of Map: Natural Resources Conservation Service Web Soil Survey URL: Coordinate System: Web Mercator (EPSG:3857) Maps from the Web Soil Survey are based on the Web Mercator projection, which preserves direction and shape but distorts distance and area. A projection that preserves area, such as the Albers equal-area conic projection, should be used if more accurate calculations of distance or area are required. This product is generated from the USDA-NRCS certified data as of the version date(s) listed below. Soil Survey Area: Saratoga County, New York Survey Area Data: Version 24, Aug 29, 2024 Soil map units are labeled (as space allows) for map scales 1:50,000 or larger. Date(s) aerial images were photographed: Sep 9, 2022—Oct 22, 2022 The orthophoto or other base map on which the soil lines were compiled and digitized probably differs from the background imagery displayed on these maps. As a result, some minor shifting of map unit boundaries may be evident. Custom Soil Resource Report 7 Map Unit Legend Map Unit Symbol Map Unit Name Acres in AOI Percent of AOI WnA Windsor loamy sand, 0 to 3 percent slopes 1.8 100.0% Totals for Area of Interest 1.8 100.0% Map Unit Descriptions The map units delineated on the detailed soil maps in a soil survey represent the soils or miscellaneous areas in the survey area. The map unit descriptions, along with the maps, can be used to determine the composition and properties of a unit. A map unit delineation on a soil map represents an area dominated by one or more major kinds of soil or miscellaneous areas. A map unit is identified and named according to the taxonomic classification of the dominant soils. Within a taxonomic class there are precisely defined limits for the properties of the soils. On the landscape, however, the soils are natural phenomena, and they have the characteristic variability of all natural phenomena. Thus, the range of some observed properties may extend beyond the limits defined for a taxonomic class. Areas of soils of a single taxonomic class rarely, if ever, can be mapped without including areas of other taxonomic classes. Consequently, every map unit is made up of the soils or miscellaneous areas for which it is named and some minor components that belong to taxonomic classes other than those of the major soils. Most minor soils have properties similar to those of the dominant soil or soils in the map unit, and thus they do not affect use and management. These are called noncontrasting, or similar, components. They may or may not be mentioned in a particular map unit description. Other minor components, however, have properties and behavioral characteristics divergent enough to affect use or to require different management. These are called contrasting, or dissimilar, components. They generally are in small areas and could not be mapped separately because of the scale used. Some small areas of strongly contrasting soils or miscellaneous areas are identified by a special symbol on the maps. If included in the database for a given area, the contrasting minor components are identified in the map unit descriptions along with some characteristics of each. A few areas of minor components may not have been observed, and consequently they are not mentioned in the descriptions, especially where the pattern was so complex that it was impractical to make enough observations to identify all the soils and miscellaneous areas on the landscape. The presence of minor components in a map unit in no way diminishes the usefulness or accuracy of the data. The objective of mapping is not to delineate pure taxonomic classes but rather to separate the landscape into landforms or landform segments that have similar use and management requirements. The delineation of such segments on the map provides sufficient information for the development of resource plans. If intensive use of small areas is planned, however, onsite investigation is needed to define and locate the soils and miscellaneous areas. Custom Soil Resource Report 8 An identifying symbol precedes the map unit name in the map unit descriptions. Each description includes general facts about the unit and gives important soil properties and qualities. Soils that have profiles that are almost alike make up a soil series. Except for differences in texture of the surface layer, all the soils of a series have major horizons that are similar in composition, thickness, and arrangement. Soils of one series can differ in texture of the surface layer, slope, stoniness, salinity, degree of erosion, and other characteristics that affect their use. On the basis of such differences, a soil series is divided into soil phases. Most of the areas shown on the detailed soil maps are phases of soil series. The name of a soil phase commonly indicates a feature that affects use or management. For example, Alpha silt loam, 0 to 2 percent slopes, is a phase of the Alpha series. Some map units are made up of two or more major soils or miscellaneous areas. These map units are complexes, associations, or undifferentiated groups. A complex consists of two or more soils or miscellaneous areas in such an intricate pattern or in such small areas that they cannot be shown separately on the maps. The pattern and proportion of the soils or miscellaneous areas are somewhat similar in all areas. Alpha-Beta complex, 0 to 6 percent slopes, is an example. An association is made up of two or more geographically associated soils or miscellaneous areas that are shown as one unit on the maps. Because of present or anticipated uses of the map units in the survey area, it was not considered practical or necessary to map the soils or miscellaneous areas separately. The pattern and relative proportion of the soils or miscellaneous areas are somewhat similar. Alpha-Beta association, 0 to 2 percent slopes, is an example. An undifferentiated group is made up of two or more soils or miscellaneous areas that could be mapped individually but are mapped as one unit because similar interpretations can be made for use and management. The pattern and proportion of the soils or miscellaneous areas in a mapped area are not uniform. An area can be made up of only one of the major soils or miscellaneous areas, or it can be made up of all of them. Alpha and Beta soils, 0 to 2 percent slopes, is an example. Some surveys include miscellaneous areas. Such areas have little or no soil material and support little or no vegetation. Rock outcrop is an example. Custom Soil Resource Report 9 Saratoga County, New York WnA—Windsor loamy sand, 0 to 3 percent slopes Map Unit Setting National map unit symbol: 2svkg Elevation: 0 to 990 feet Mean annual precipitation: 36 to 71 inches Mean annual air temperature: 39 to 55 degrees F Frost-free period: 140 to 240 days Farmland classification: Farmland of statewide importance Map Unit Composition Windsor, loamy sand, and similar soils:85 percent Minor components:15 percent Estimates are based on observations, descriptions, and transects of the mapunit. Description of Windsor, Loamy Sand Setting Landform:Outwash plains, outwash terraces, deltas, dunes Landform position (three-dimensional):Tread, riser Down-slope shape:Linear, convex Across-slope shape:Linear, convex Parent material:Loose sandy glaciofluvial deposits derived from granite and/or loose sandy glaciofluvial deposits derived from schist and/or loose sandy glaciofluvial deposits derived from gneiss Typical profile O - 0 to 1 inches: moderately decomposed plant material A - 1 to 3 inches: loamy sand Bw - 3 to 25 inches: loamy sand C - 25 to 65 inches: sand Properties and qualities Slope:0 to 3 percent Depth to restrictive feature:More than 80 inches Drainage class:Excessively drained Runoff class: Low Capacity of the most limiting layer to transmit water (Ksat):Moderately high to very high (1.42 to 99.90 in/hr) Depth to water table:More than 80 inches Frequency of flooding:None Frequency of ponding:None Maximum salinity:Nonsaline (0.0 to 1.9 mmhos/cm) Available water supply, 0 to 60 inches: Low (about 3.6 inches) Interpretive groups Land capability classification (irrigated): None specified Land capability classification (nonirrigated): 2s Hydrologic Soil Group: A Ecological site: F144AY022MA - Dry Outwash Hydric soil rating: No Custom Soil Resource Report 10 Minor Components Deerfield, loamy sand Percent of map unit:10 percent Landform:Deltas, terraces, outwash plains Landform position (two-dimensional):Footslope Landform position (three-dimensional):Tread, talf Down-slope shape:Linear Across-slope shape:Linear Hydric soil rating: No Hinckley, loamy sand Percent of map unit:5 percent Landform:Deltas, kames, eskers, outwash plains Landform position (two-dimensional):Summit, shoulder, backslope Landform position (three-dimensional):Nose slope, side slope, crest, head slope, rise Down-slope shape:Convex Across-slope shape:Convex, linear Hydric soil rating: No Custom Soil Resource Report 11 References American Association of State Highway and Transportation Officials (AASHTO). 2004. Standard specifications for transportation materials and methods of sampling and testing. 24th edition. American Society for Testing and Materials (ASTM). 2005. Standard classification of soils for engineering purposes. ASTM Standard D2487-00. Cowardin, L.M., V. Carter, F.C. Golet, and E.T. LaRoe. 1979. Classification of wetlands and deep-water habitats of the United States. U.S. Fish and Wildlife Service FWS/OBS-79/31. Federal Register. July 13, 1994. Changes in hydric soils of the United States. Federal Register. September 18, 2002. Hydric soils of the United States. Hurt, G.W., and L.M. Vasilas, editors. Version 6.0, 2006. Field indicators of hydric soils in the United States. National Research Council. 1995. Wetlands: Characteristics and boundaries. Soil Survey Division Staff. 1993. Soil survey manual. Soil Conservation Service. U.S. Department of Agriculture Handbook 18. http://www.nrcs.usda.gov/wps/portal/ nrcs/detail/national/soils/?cid=nrcs142p2_054262 Soil Survey Staff. 1999. Soil taxonomy: A basic system of soil classification for making and interpreting soil surveys. 2nd edition. Natural Resources Conservation Service, U.S. Department of Agriculture Handbook 436. http:// www.nrcs.usda.gov/wps/portal/nrcs/detail/national/soils/?cid=nrcs142p2_053577 Soil Survey Staff. 2010. Keys to soil taxonomy. 11th edition. U.S. Department of Agriculture, Natural Resources Conservation Service. http:// www.nrcs.usda.gov/wps/portal/nrcs/detail/national/soils/?cid=nrcs142p2_053580 Tiner, R.W., Jr. 1985. Wetlands of Delaware. U.S. Fish and Wildlife Service and Delaware Department of Natural Resources and Environmental Control, Wetlands Section. United States Army Corps of Engineers, Environmental Laboratory. 1987. Corps of Engineers wetlands delineation manual. Waterways Experiment Station Technical Report Y-87-1. United States Department of Agriculture, Natural Resources Conservation Service. National forestry manual. http://www.nrcs.usda.gov/wps/portal/nrcs/detail/soils/ home/?cid=nrcs142p2_053374 United States Department of Agriculture, Natural Resources Conservation Service. National range and pasture handbook. http://www.nrcs.usda.gov/wps/portal/nrcs/ detail/national/landuse/rangepasture/?cid=stelprdb1043084 12 United States Department of Agriculture, Natural Resources Conservation Service. National soil survey handbook, title 430-VI. http://www.nrcs.usda.gov/wps/portal/ nrcs/detail/soils/scientists/?cid=nrcs142p2_054242 United States Department of Agriculture, Natural Resources Conservation Service. 2006. Land resource regions and major land resource areas of the United States, the Caribbean, and the Pacific Basin. U.S. Department of Agriculture Handbook 296. http://www.nrcs.usda.gov/wps/portal/nrcs/detail/national/soils/? cid=nrcs142p2_053624 United States Department of Agriculture, Soil Conservation Service. 1961. Land capability classification. U.S. Department of Agriculture Handbook 210. http:// www.nrcs.usda.gov/Internet/FSE_DOCUMENTS/nrcs142p2_052290.pdf Custom Soil Resource Report 13 Appendix F Map Set Appendix G SWPPP Inspection Form JW Hemmingway PUD WEEKLY SWPPP INSPECTION REPORT Inspector Name: Date: Signature (required): Time: Weather: Inspection #: Soil Conditions (dry, saturated, etc): Note: Digital photos, with date stamp required for all practices requiring corrective action, before and after, to be attached to the inspection report. YES NO N/A 1. Routine Inspection. Date of last inspection: 2. Inspection following rain event. Date/time of storm ending: Rainfall amount: Recorded by: 3. Is this a final site inspection? 4. Has site undergone final stabilization? If so, have all temporary erosion and sediment controls been removed? Site Disturbance (Indicate Locations on Plan) YES NO N/A 1. Areas previously disturbed, but have not undergone active site work in the last 7 days? 2. Areas disturbed within last 7 days? 3. Areas expected to be disturbed in next 7 days? 4. Do areas of steep slopes or complex stabilization issues exist? If “YES” explain: 5. Are there currently more than 5 acres of disturbed soil at the site? If so make sure there is an approval letter from NYS DEC. Additional Comments: Inspection of Erosion and Sediment Control Devices Type of Control Device Accumulation (if any) in % Repairs/Maintenance Needed 1. 2. 3. 4. 5. 6. Stabilization/Runoff YES NO N/A 1. Are all existing disturbed areas contained by control devices? Type of devices: 2. Are there areas that require stabilization within the next 7 days? Specify Area: 3. Have stabilization measures been initiated in inactive areas? 4. Is there current snow cover or frozen ground conditions? 5. Rills or gullies? 6. Slumping/deposition? 7. Loss of vegetation? 8. Lack of germination? 9. Loss of mulching? Receiving Structures/Water Bodies (Indicate locations where runoff leaves the project site on the site plan) YES NO N/A 1. Surface water swale or natural surface waterbody? If natural waterbody: Is waterbody located onsite, or adjacent to property boundary? Description of condition: 2. Municipal or community system? Inspect locations where runoff from project site enters the receiving waters and indicate if there is evidence of: a. Rills or gullies? b. Slumping/deposition? c. Loss of vegetation? d. Undermining of structures? e. Was there a discharge into the receiving water on the day of inspection? f. Is there evidence of turbidity, sedimentation, or oil in the receiving waters? Additional Comments: Inspection of Post-Construction Stormwater Management Control Devices Type of Control Device Phase of Construction Repairs/Maintenance Needed 1. 2. 3. 4. General Site Condition YES NO N/A 1. Have action items from previous reports been addressed? 2. Does routine maintenance of protection components occur on a regular basis? 3. Does cleaning and/or sweeping affected roadways occur, at minimum, daily? 4. Is debris and litter removed on a monthly basis, or as necessary? 5. Is the site maintained in an orderly manner? Describe the condition of all natural waterbodies within or adjacent to the Project that receive runoff from the site: Contractors progress over last 7 days: Anticipated work to be begun in the next 7 days: Additional Comments: Visual Observations YES NO N/A 1. All erosion and sediment control measures have been installed/constructed? 2. All erosion and sediment control measures are being maintained properly? SUMMARY OF ACTION ITEMS TO REPAIR/REPLACE/MAINTAIN/CORRECT DEFICIENCIES Action Reported To (no signature required): Company: Appendix H Other SWPPP Forms Construction Sequence SWPPP Plan Changes Spill Response Form The contractor shall prepare a summary of construction status using the Construction Sequence Form below once every month. Significant deviations to the sequence and reasons for those deviations (i.e. weather, subcontractor availability, etc.), shall be noted by the contractor. The schedule shall be used to record the dates for initiation of construction, implementation of erosion control measures, stabilization, etc. A copy of this table will be maintained at the construction site and updated in addition to the individual Inspection Reports completed for each inspection. Construction Sequence Form Construction Activities (Identify name of planned practices) Date Complete 1. 2. 3. 4. 5. 6. 7. 8. 9. 10. 11. 12. STORM WATER POLLUTION PREVENTION PLAN PLAN CHANGES, AUTHORIZATION, AND CHANGE CERTIFICATION CHANGES REQUIRED TO THE POLLUTION PREVENTION PLAN: REASONS FOR CHANGES: REQUESTED BY: _________________________ DATE: _________________________ AUTHORIZED BY: _________________________ DATE: _________________________ CERTIFICATION OF CHANGES: I certify under penalty of law that this document and all attachments were prepared under my direction or supervision in accordance with a system designed to assure that qualified personnel properly gathered and evaluated the information submitted. Based on my inquiry of the person or persons who manage the system, or those persons directly responsible for gathering the information, the information submitted is, to the best of my knowledge and belief, true, accurate, and complete. I am aware that false statements made herein are punishable as a Class A misdemeanor pursuant to Section 210.45 of the penal code. SIGNATURE: DATE: SPILL RESPONSE REPORT Within 1 hour of a spill the following must be notified: John Witt (518)-630-4185 NYSDEC Spill Response Hotline 1-800-457-7362 Spill Response Contractor Material Spilled: Approximate Volume: Location: Distance to nearest down gradient drainage: Distance to nearest down gradient open water: Temporary control measures in place: Appendix I SPDES General Permit GP-0-25-001 PREFACE Pursuant to Section 402 of the Clean Water Act (CWA), and 40 CFR 122.26(b)(14)(x), (15)(i), and (15)(ii), stormwater discharges from certain construction activities are unlawful unless they are authorized by a National Pollutant Discharge Elimination System (NPDES) permit or by a state permit program. New York State administers the approved State Pollutant Discharge Elimination System (SPDES) program with permits issued in accordance with the New York State Environmental Conservation Law (ECL) Article 17, Titles 7 and 8, and Article 70, as well as 6 NYCRR Parts 621 and 750. Construction activities constitute construction of a point source and, therefore, pursuant to ECL sections 17-0505, 17-0701, and 17-0803, the owner or operator must have coverage under a SPDES permit prior to commencement of construction activities. The owner or operator cannot wait until there is an actual discharge from the construction site to obtain permit coverage. *Note: The italicized words/phrases within this permit are defined in Appendix A. NEW YORK STATE DEPARTMENT OF ENVIRONMENTAL CONSERVATION SPDES CONSTRUCTION GENERAL PERMIT (CGP) GP-0-25-001 FOR STORMWATER DISCHARGES FROM CONSTRUCTION ACTIVITIES Table of Contents Part I. How to Obtain Coverage and General Requirements ..................................... 5 A. Eligibility Requirements...................................................................................... 5 B. Types of Discharges Authorized ........................................................................ 9 C. Prohibited Discharges ...................................................................................... 10 D. Electronic Notice of Intent (eNOI) Submittal..................................................... 10 E. General Requirements for Owners or Operators with Permit Coverage .......... 14 F. Permit Coverage for Discharges Authorized Under GP-0-20-001.................... 18 G. Change of Owner or Operator.......................................................................... 19 Part II. Water Quality-Based Effluent Limitations..................................................... 20 A. Maintaining Water Quality ................................................................................ 20 B. Effluent Limitations Applicable to Discharges from Construction Activities ...... 20 C. Post-Construction Stormwater Management Practice (SMP) Requirements ... 23 Part III. Stormwater Pollution Prevention Plan (SWPPP)......................................... 28 A. General SWPPP Requirements ....................................................................... 28 B. Required SWPPP Contents ............................................................................. 32 C. Required SWPPP Components by Project Type.............................................. 37 Part IV. Inspection and Maintenance Requirements ................................................ 37 A. General Construction Site Inspection and Maintenance Requirements ........... 37 B. Contractor Maintenance Inspection Requirements .......................................... 37 C. Qualified Inspector Inspection Requirements................................................... 38 Part V. How to Terminate CGP Coverage.................................................................. 43 A. Electronic Notice of Termination (eNOT) Submittal.......................................... 43 Part VI. Record Retention and Reporting.................................................................. 45 A. Record Retention ............................................................................................. 46 B. Reporting ......................................................................................................... 46 Part VII. Standard Permit Requirements ................................................................... 46 A. Duty to Comply................................................................................................. 46 B. Need to Halt or Reduce Activity Not a Defense................................................ 46 C. Penalties .......................................................................................................... 46 D. False Statements ............................................................................................. 47 E. Re-Opener Clause ........................................................................................... 47 F. Duty to Mitigate ................................................................................................ 47 G. Requiring Another General Permit or Individual SPDES Permit....................... 47 H. Duty to Provide Information.............................................................................. 49 I. Extension ......................................................................................................... 49 J. Signatories and Certification ............................................................................ 50 K. Inspection and Entry ........................................................................................ 52 L. Confidentiality of Information............................................................................ 53 M. Other Permits May Be Required ...................................................................... 53 N. NYSDEC Orders or Civil Decrees/Judgments.................................................. 53 O. Property Rights ................................................................................................ 53 P. Compliance with Interstate Standards.............................................................. 53 Q. Oil and Hazardous Substance Liability............................................................. 54 R. Severability....................................................................................................... 54 S. NYSDEC Approved Forms............................................................................... 54 APPENDIX A – Abbreviations and Definitions.......................................................... 55 Abbreviations............................................................................................................. 55 Definitions.................................................................................................................. 56 APPENDIX B – Required SWPPP Components by Project Type............................. 64 Table 1....................................................................................................................... 64 Table 2....................................................................................................................... 66 APPENDIX C – Watersheds Requiring Enhanced Phosphorus Removal............... 68 APPENDIX D – Impaired Waterbodies (by Construction Related Pollutants) ........ 74 APPENDIX E – List of NYSDEC Regional Offices..................................................... 80 APPENDIX F – SWPPP Preparer Certification Form ................................................ 81 APPENDIX G – MS4 SWPPP Acceptance Form........................................................ 83 APPENDIX H – NYCDEP SWPPP Acceptance/Approval Form ................................ 86 APPENDIX I – MS4 No Jurisdiction Form.................................................................. 89 APPENDIX J – Owner/Operator Certification Form.................................................. 91 Part I. Part I. How to Obtain Coverage and General Requirements To be covered under this permit, the owner or operator must meet all eligibility requirements in Part I.A. and follow the requirements for obtaining permit coverage in Part I.D., F., or G. A. Eligibility Requirements For a common plan of development or sale, the phase(s) that meet the eligibility requirements in Part I.A. may obtain coverage under this permit even if other phase(s) of the same common plan of development or sale do not meet the eligibility requirements and require an individual SPDES permit. 1. The owner’s or operator’s construction activities involve soil disturbances of: a. one or more acres; or b. less than one acre which are part of a common plan of development or sale that will ultimately disturb one or more acres; or c. less than one acre where NYSDEC has determined that a SPDES permit is required for stormwater discharges based on the potential for contribution to a violation of a water quality standard or for significant contribution of pollutants to surface waters of the State. i. 5,000 square feet or more, but less than one acre, and are in the New York City Watershed located east of the Hudson River, Appendix C Figure 1; or ii. 20,000 square feet or more, but less than one acre, within the municipal boundaries of the City of New York (NYC); or iii. less than 20,000 square feet which are part of a common plan of development or sale that will ultimately disturb 20,000 square feet or more, but less than one acre, within the municipal boundaries of NYC; or iv. that creates 5,000 square feet or more of impervious area within the municipal boundaries of NYC. 5 Part I.A.2. 2. Discharges from the owner’s or operator’s construction activities are/were not: a. already covered by a different SPDES permit; or b. covered under a different SPDES permit that was denied, terminated, or revoked; or c. identified in an expired individual SPDES permit that was not renewed; or d. required to obtain an individual SPDES permit or another general SPDES permit in accordance with Part VII.K. 3. If construction activities may adversely affect a species that is endangered or threatened, the owner or operator must obtain a: a. permit issued pursuant to 6 NYCRR Part 182 for the project; or b. letter issued by NYSDEC of non-jurisdiction pursuant to 6 NYCRR Part 182 for the project. 4. If construction activities have the potential to affect an historic property, the owner or operator must obtain one of the following: a. documentation that the construction activity is not within an archeological buffer area indicated on the sensitivity map, and that the construction activity is not located on or immediately adjacent to a property listed or determined to be eligible for listing on the National or State Registers of Historic Places, and that there is no new permanent building on the construction site within the following distances from a building, structure, or object that is more than 50 years old, or if there is such a new permanent building on the construction site within those parameters that NYS Office of Parks, Recreation and Historic Preservation (OPRHP), a Historic Preservation Commission of a Certified Local Government, or a qualified preservation professional has determined that the building, structure, or object more than 50 years old is not historically/archeologically significant: i. 1-5 acres of disturbance - 20 feet; or ii. 5-20 acres of disturbance - 50 feet; or 6 Part I.A.4.a.iii. iii. 20+ acres of disturbance - 100 feet. b. NYSDEC consultation form sent to OPRHP,1 and copied to NYSDEC’s Agency Historic Preservation Officer (APO), and i. the State Environmental Quality Review Act (SEQR) Environmental Assessment Form (EAF) with a negative declaration or the Findings Statement, with documentation of OPRHP’s agreement with the resolution; or ii. documentation from OPRHP that the construction activity will result in No Impact; or iii. documentation from OPRHP providing a determination of No Adverse Impact; or iv. a Letter of Resolution signed by the owner or operator, OPRHP and the DEC APO which allows for this construction activity to be eligible for coverage under the general permit in terms of the State Historic Preservation Act (SHPA). c. documentation of satisfactory compliance with Section 106 of the National Historic Preservation Act for a coterminous project area: i. No Affect; or ii. No Adverse Affect; or iii. Executed Memorandum of Agreement. d. documentation that SHPA Section 14.09 has been completed by NYSDEC or another state agency. 5. If construction activities are subject to SEQR, the owner or operator must obtain documentation that SEQR has been satisfied. 6. If construction activities are not subject to SEQR, but subject to the equivalent environmental review from another New York State or federal agency, the 1 The consultation form can be submitted, along with other project information, through OPRHP's Cultural Resource Information System (CRIS) portal. If submitted through CRIS, paper copies of the consultation form need not be mailed. 7 Part I.A.6. owner or operator must obtain documentation that project review, pursuant to a process equivalent to SEQR from another New York State or federal agency, has been satisfied. 7. If construction activities require Uniform Procedures Act (UPA) Permits (see 6 NYCRR Part 621) from NYSDEC, or the equivalent from another New York State or federal agency, the owner or operator must: a. obtain all such necessary permits; or b. receive notification from NYSDEC pursuant to 6 NYCRR 621.3(a)(4) excepting Part I.A.7.a. 8. Construction activities are not eligible if they meet the following criteria in Part I.A.8.a. or b.: a. For linear transportation and linear utility project types, the construction activities: i. are within the watershed of surface waters of the State classified as AA or AA-S identified utilizing the Stormwater Interactive Map on NYSDEC’s website; and ii. are undertaken on land with no existing impervious cover; and iii. disturb two or more acres of steep slope. b. For all other project types, the construction activities: i. are within the watershed of surface waters of the State classified as AA or AA-S identified utilizing the Stormwater Interactive Map on NYSDEC’s website; and ii. are undertaken on land with no existing impervious cover; and iii. disturb one or more acres of steep slope. 8 Part I.B. B. Types of Discharges Authorized 1. The following stormwater discharges are authorized under this permit: a. Stormwater discharges, including stormwater runoff, snowmelt runoff, and surface runoff and drainage, associated with construction activity, are authorized under this permit provided that appropriate stormwater controls are designed, installed, and maintained in accordance with Part II. and Part III. b. Stormwater discharges from construction support activities at the construction site (including concrete or asphalt batch plants, equipment staging yards, material storage areas, excavated material disposal areas, and borrow areas) if the following requirements are met: i. The support activity is directly related to the construction site required to have permit coverage for stormwater discharges; and ii. The support activity is not a commercial operation, nor does it serve multiple unrelated construction sites; and iii. The support activity does not continue to operate beyond the completion of the construction activity at the site it supports; and iv. Stormwater controls are implemented in accordance with Part II. and Part III. for discharges from the support activity areas. 2. The following non-stormwater discharges associated with construction activity are authorized under this permit: a. Non-stormwater discharges listed in 6 NYCRR 750-1.2(a)(29)(vi), with the following exception: “Discharges from firefighting activities are authorized only when the firefighting activities are emergencies/unplanned”; and b. Non-stormwater discharges of waters to which other components have not been added that are used in accordance with the SWPPP to control dust or irrigate vegetation in stabilized areas; and c. Uncontaminated discharges from dewatering operations 9 Part I.B.3. 3. Authorized discharges of stormwater or authorized discharges of non- stormwater, commingled with a discharge authorized by a different SPDES permit and/or a discharge that does not require SPDES permit authorization, are also authorized under this permit. C. Prohibited Discharges 1. Non-stormwater discharges prohibited under this permit include but are not limited to: a. Wastewater from washout of concrete; and b. Wastewater from washout and cleanout of stucco, paint, form release oils, curing compounds, and other construction materials; and c. Fuels, oils, or other pollutants used in vehicle and equipment operation and maintenance; and d. Soaps, solvents, or detergents used in vehicle and equipment washing or external building washdown; and e. Toxic or hazardous substances from a spill or other release. D. Electronic Notice of Intent (eNOI) Submittal To receive authorization in accordance with Part I.D.3.b., the owner or operator must submit a complete eNOI in accordance with the requirements in Part I.D. The eNOI contains questions to: ensure eligibility requirements in Part I.A. have been met; obtain owner or operator contact information; obtain the total area to be disturbed and the existing/future impervious areas (rounded to the nearest tenth of an acre); confirm Traditional Land Use Control MS4 Operator jurisdiction over construction projects; satisfy the EPA eRule requirements; confirm that the Water Quality-Based Effluent Limitations in Part II. have been met; demonstrate consideration of the future risks due to climate change in accordance with Part III.A.2.; and confirm that the other Stormwater Pollution Prevention Plan (SWPPP) requirements in Part III. have been met. 1. An eNOI may be submitted for: a. construction activities that are not part of a common plan of development or sale; or 10 Part I.D.1.b. b. an entire common plan of development or sale; or c. separate phase(s) of a common plan of development or sale if the following requirements are met: i. the common plan of development or sale meets the eligibility requirements of Part I.A.5. or 6.; and ii. the phase(s) meet(s) all other eligibility requirements of Part I.A.; and iii. Part III.C. Required SWPPP Components by Project Type is based on the common plan of development or sale, not the phase(s); or d. tree clearing that is associated with, or will support, a renewable energy generation, transmission, or storage project that meets Part I.A.5. and 6., if the tree clearing: i. meets all other eligibility requirements of Part I.A.; and ii. will occur in NYSDEC’s Regions 3-9; and iii. is not within ¼ mile of a bat hibernaculum protected pursuant to 6 NYCRR Part 182; and iv. will occur between November 1st and March 31st. 2. As prerequisites for submitting an eNOI, the owner or operator must: a. prepare a SWPPP for Part I.D.1.a., b., c., or d. in accordance with Part III.; and b. based on the following criteria, upload the following signature forms signed in accordance with Part VII.J. to the eNOI prior to submission: i. for all eNOIs: 1. the SWPPP Preparer Certification Form, Appendix F, signed by the SWPPP preparer; and 11 Part I.D.2.b.i.2. 2. the Owner/Operator Certification Form, Appendix J, signed by the owner or operator; and ii. if an eNOI includes construction activities within the municipal boundary(ies) of Traditional Land Use Control MS4 Operator(s) that will discharge to the MS4(s): 1. determine if the Traditional Land Use Control MS4 Operator(s) have review authority. A Traditional Land Use Control MS4 Operator does not have review authority where: a. the owner or operator of the construction activities in Part I.D.2.b.ii. is the same entity as the Traditional Land Use Control MS4 Operator identified in Part I.D.2.b.ii.; or b. there is a statute exempting the owner or operator from zoning review by the Traditional Land Use Control MS4 Operator; or c. there is no such statute per Part I.D.2.b.ii.1.b., the Traditional Land Use Control MS4 Operator concludes, after public hearing, that it does not have zoning review authority in accordance with Legal Memorandum LU14 Updated January 2020 “Governmental Immunity from Zoning and Other Legislation”; and 2. if the Traditional Land Use Control MS4 Operator(s) have review authority, submit the SWPPP to the Traditional Land Use Control MS4 Operator(s) for review and have: a. if outside the municipal boundaries of NYC: the MS4 SWPPP Acceptance Form, Appendix G, signed by the principal executive officer or ranking elected official from the Traditional Land Use Control MS4 Operator, or by a duly authorized representative of that person in accordance with Part VII.J.2.; or 12 Part I.D.2.b.ii.2.b. b. if within the municipal boundaries of NYC: The City of New York Department of Environmental Protection (NYCDEP) SWPPP Acceptance/Approval Form, Appendix H, signed by the principal executive officer or ranking elected official from the Traditional Land Use Control MS4 Operator, or by a duly authorized representative of that person in accordance with Part VII.J.2.; and 3. if the Traditional Land Use Control MS4 Operator does not have review authority, have the MS4 No Jurisdiction Form, Appendix I, signed by the principal executive officer or ranking elected official from the Traditional Land Use Control MS4 Operator, or by a duly authorized representative of that person in accordance with Part VII.J.2. 3. Submitting an eNOI: a. The owner or operator must submit a complete Notice of Intent electronically using a NYSDEC approved form.2 b. The owner or operator is authorized to commence construction activity as of the authorization date indicated in the Letter of Authorization (LOA), which is sent by NYSDEC after a complete eNOI is submitted. i. If an eNOI is received for a SWPPP that deviates from one of the technical standards but demonstrates equivalence in accordance with Part III.B.1.a.ii. or Part III.B.2.b.ii., if the SWPPP includes construction activities that are not within the municipal boundary(ies) of Traditional Land Use Control MS4 Operator(s), and/or if the SWPPP includes construction activities within the municipal boundary(ies) of Traditional Land Use Control MS4 Operator(s) that do not have review authority in accordance with Part I.D.2.b.ii.1., the authorization date indicated in the LOA will be 60 business days after the eNOI submission date. 2 Unless NYSDEC grants a waiver in accordance with 40 CFR 127.15(c) or (d). All waiver requests must be submitted to Stormwater_info@dec.ny.gov or NYSDEC, Bureau of Water Permits, 625 Broadway, 4th Floor, Albany, New York 12233-3505. 13 Part I.D.3.c. c. If Traditional Land Use Control MS4 Operator(s) have review authority in accordance with Part I.D.2.b.ii.2., the owner or operator must, within five business days of receipt of the LOA, send an electronic copy of the LOA to the Traditional Land Use Control MS4 Operator(s) with review authority. E. General Requirements for Owners or Operators with Permit Coverage 1. As of the date the LOA is received, the owner or operator must make the eNOI, SWPPP, and LOA available for review and copying in accordance with the requirements in Part VII.H. When applicable, as of the date an updated LOA is received, the owner or operator must make the updated LOA available for review and copying in accordance with the requirements in Part VII.H. 2. The owner or operator must ensure compliance with all requirements of this permit and that the provisions of the SWPPP, including any changes made to the SWPPP in accordance with Part III.A.5., are properly implemented and maintained from the commencement of construction activity until: a. all areas of disturbance have achieved final stabilization; and b. the owner’s or operator’s coverage under this permit is terminated in accordance with Part V.A.5.a. 3. As of the date of the commencement of construction activities until Part I.E.2.a. and b. have been met, the owner or operator must maintain at the construction site, a copy of: a. all documentation necessary to demonstrate eligibility with this permit; and b. this permit; and c. the SWPPP; and d. the signed SWPPP Preparer Certification Form; and e. the signed MS4 SWPPP Acceptance Form or signed NYCDEP SWPPP Acceptance/Approval Form or signed MS4 No Jurisdiction Form (when applicable); and f. the signed Owner/Operator Certification Form; and 14 Part I.E.3.g. g. the eNOI; and h. the LOA; and i. the LOA transmittal to the Traditional Land Use Control MS4 Operator in accordance with Part I.D.3.c. (when applicable). 4. The owner or operator must maintain at the construction site, until Part I.E.2.a. and b. have been met, as of the date the documents become final or are received, a copy of the: a. responsible contractor’s or subcontractor’s certification statement(s) in accordance with Part III.A.7.; and b. inspection reports in accordance with Part IV.C.4. and 6.; and c. Request to Disturb Greater Than Five Acres and the Authorization Letter to Disturb Greater Than Five Acres in accordance with Part I.E.6. (when applicable); and d. Request to Continue Coverage and the Letter of Continued Coverage (LOCC) in accordance with Part I.F.2. and 4. (when applicable); and e. The updated LOA(s) in accordance with Part I.E.9. (when applicable). 5. The owner or operator must maintain the documents in Part I.E.3. and 4. in a secure location, such as a job trailer, on-site construction office, or mailbox with lock. The secure location must be accessible during normal business hours to an individual performing a compliance inspection. The documents must be paper documents unless electronic documents are accessible to the inspector during an inspection to the same extent as a paper copy stored at the site would be. If electronic documents are kept on site, the owner or operator must maintain functional equipment on site available to an inspector during normal hours of operation such that an inspector may view the electronic documents in a format that can be read in a similar manner as a paper record and in a legally dependable format with no less evidentiary value than their paper equivalent. 6. The owner or operator must meet the following requirements prior to disturbing greater than five acres of soil at any one time: a. The owner or operator must submit a written Request to Disturb Greater Than Five Acres to: 15 Part I.E.6.a.i. i. NYSDEC’s Regional Office Division of Water staff based on the project location, Appendix E, if a Traditional Land Use Control MS4 Operator does not have review authority in accordance with Part I.D.2.b.ii.1.; or ii. the Traditional Land Use Control MS4 Operator, if a Traditional Land Use Control MS4 Operator has review authority in accordance with Part I.D.2.b.ii.1.; or iii. NYSDEC’s Regional Office Division of Water staff based on the project location, Appendix E, and each involved Traditional Land Use Control MS4 Operator, if the project spans multiple municipalities with more than one Traditional Land Use Control MS4 Operator involved with review authority in accordance with Part I.D.2.b.ii.1. b. The written Request to Disturb Greater Than Five Acres must include: i. The SPDES permit identification number (Permit ID); and ii. Full technical justification demonstrating why alternative methods of construction that would result in five acres of soil disturbance or less at any one time are not feasible; and iii. The phasing plan for the project and sequencing plans for all phases from the SWPPP in accordance with Part III.B.1.d.; and iv. Plans with locations and details of erosion and sediment control practices such that the heightened concern for erosion when disturbing greater than five acres at one time has been addressed; and v. Acknowledgment that “the owner or operator will comply with the requirements in Part IV.C.2.b.”; and vi. Acknowledgment that “the owner or operator will comply with the requirements in Part II.B.1.b.” c. The owner or operator must be in receipt of an Authorization Letter to Disturb Greater Than Five Acres, which will include when the 16 Part I.E.6.c. authorization begins and ends and indicate a maximum area (acres) of soil disturbance allowed at any one time, from: i. NYSDEC, if Part I.E.6.a.i. or iii. apply; or ii. the Traditional Land Use Control MS4 Operator, if Part I.E.6.a.ii. applies. 7. Upon a finding of significant non-compliance with the practices described in the SWPPP or violation of this permit, NYSDEC may order an immediate stop to all construction activity at the site until the non-compliance is remedied. The stop work order must be in writing, describe the non-compliance in detail, and be sent to the owner or operator. 8. If any human remains or archaeological remains are encountered during excavation, the owner or operator must immediately cease, or cause to cease, all construction activity in the area of the remains and notify the appropriate Regional Water Engineer (RWE).3 Construction activity shall not resume until written permission to do so has been received from the RWE. 9. To be authorized to implement modifications to the information previously submitted in the eNOI, the owner or operator must: a. notify NYSDEC via email at Stormwater_info@dec.ny.gov requesting access to update the eNOI; and b. update the eNOI to reflect the modifications and resubmit the eNOI in accordance with Part I.D.; and c. receive an updated LOA. 10.The eNOI, SWPPP, LOA, updated LOAs (when applicable), and inspection reports required by this permit are public documents that the owner or operator must make available for review and copying by any person within five business days of the owner or operator receiving a written request by any such person to review these documents. Copying of documents will be done at the requester’s expense. 3 The Regional Water Manager where a DEC Region does not have a RWE. 17 Part I.F. F. Permit Coverage for Discharges Authorized Under GP-0-20-001 When applicable: 1. Upon the effective date of this permit, an owner or operator of a construction activity, with coverage under GP-0-20-001, will have interim coverage under GP-0-25-001 for 45 calendar days starting on the effective date of GP-0-25- 001 so long as the owner or operator maintains compliance with all applicable requirements of this permit. 2. Within 30 calendar days of the effective date of this permit, the owner or operator, with coverage under GP-0-20-001, must submit a complete Request to Continue Coverage electronically using a NYSDEC approved form,4 which contains the information identified in Part I.F.3. below, if: a. the owner or operator continues to implement the SMP component in conformance with the technical standards in place at the time of initial project authorization; and b. the owner or operator will comply with all non-design requirements of GP- 0-25-001. 3. The Request to Continue Coverage form contains questions to: ensure eligibility requirements in Part I.A. have been met; verify owner or operator contact information; verify the permit identification number; verify the original eNOI submission ID, if applicable; verify Part I.F.2.a. and b.; verify the version of the Design Manual that the technical/design components conform to; and receive an updated Owner/Operator Certification Form, Appendix I. 4. The owner or operator has obtained continued coverage under GP-0-25-001 as of the date indicated in the LOCC, which is sent by NYSDEC after a complete Request to Continue Coverage form is submitted. 5. If the owner or operator does not submit the Request to Continue Coverage form in accordance with Part I.F.2. and 3., coverage under this permit is automatically terminated after interim coverage expires. 4 Unless NYSDEC grants a waiver in accordance with 40 CFR 127.15(c) or (d). All waiver requests must be submitted to Stormwater_info@dec.ny.gov or NYSDEC, Bureau of Water Permits, 625 Broadway, 4th Floor, Albany, New York 12233-3505. 18 Part I.G. G. Change of Owner or Operator When applicable: 1. When property ownership changes, or when there is a change in operational control over the construction plans and specifications, the following process applies: a. The new owner or operator must meet the applicable prerequisites for submitting an eNOI in accordance with Part I.D.2.; and b. The new owner or operator must submit an eNOI in accordance with Part I.D.3.; and c. Permit coverage for the new owner or operator will be effective upon receipt of the LOA in accordance with Part I.D.3.b.; and d. The new owner or operator, upon receipt of their LOA, must provide their Permit ID to the original owner or operator; and e. If the original owner or operator will no longer be the owner or operator of the construction activity identified in the original owner’s or operator’s eNOI, the original owner or operator, upon receipt of the new owner’s or operator’s Permit ID in accordance with Part I.G.1.d., must submit to NYSDEC a completed eNOT in accordance with Part V. that includes the name and Permit ID of the new owner or operator; or f. If the original owner or operator maintains ownership of a portion of the construction activity, the original owner or operator must maintain their coverage under the permit by modifying their eNOI; modifications to the eNOI must include: i. the revised area of disturbance and/or impervious area(s); and ii. the revised SMP information, if applicable; and iii. a narrative description of what has changed; and iv. the new owner’s or operator’s Permit ID for the portion of the project removed from the eNOI. Owners or operators must follow Part I.E.9. to modify the eNOI. 19 Part II. Part II. Water Quality-Based Effluent Limitations A. Maintaining Water Quality NYSDEC expects that compliance with the requirements of this permit will control discharges necessary to meet applicable water quality standards. It shall be a violation of the ECL for any discharge to either cause or contribute to a violation of the following water quality standards as contained in Parts 700 through 705 of Title 6 of the Official Compilation of Codes, Rules and Regulations of the State of New York: 1. There must be no increase in turbidity that will cause a substantial visible contrast to natural conditions; and 2. There must be no increase in suspended, colloidal or settleable solids that will cause deposition or impair the waters for their best usages; and 3. There must be no residue from oil and floating substances, nor visible oil film, nor globules of grease. If there is evidence indicating that the stormwater discharges authorized by this permit are causing, have the reasonable potential to cause, or are contributing to a violation of the water quality standard, the owner or operator must take appropriate corrective action in accordance with Part IV.C.5. of this permit and document in accordance with Part IV.C.4. of this permit. To address the water quality standard violation the owner or operator must include and implement appropriate controls in the SWPPP to correct the problem or obtain an individual SPDES permit. If, despite compliance with the requirements of this permit, it is demonstrated that the stormwater discharges authorized by this permit are causing or contributing to a violation of water quality standards, or if NYSDEC determines that a modification of this permit is necessary to prevent a violation of water quality standards, the authorized discharges will no longer be eligible for coverage under this permit, and the owner or operator must obtain an individual SPDES permit prior to further discharges from the construction site. B. Effluent Limitations Applicable to Discharges from Construction Activities Discharges authorized by this permit must achieve, at a minimum, the effluent limitations in Part II.B.1.a., b., c., d., and e. These limitations represent the 20 Part II.B. degree of effluent reduction attainable by the application of best practicable technology currently available. 1. Erosion and Sediment Control Requirements - The owner or operator must select, design, install, implement, and maintain control measures to minimize the discharge of pollutants and prevent a violation of the water quality standards. The selection, design, installation, implementation, and maintenance of these control measures must meet the non-numeric effluent limitations in Part II.B.1.a., b., c., d., and e. and be in accordance with the New York State Standards and Specifications for Erosion and Sediment Control (BB), dated November 2016, using sound engineering judgment. Where control measures are not designed in conformance with the design criteria included in the technical standard, the owner or operator must include in SWPPP the reason(s) for the deviation, or alternative design, and provide information in the SWPPP demonstrating that the deviation or alternative design is equivalent to the technical standard. a. Erosion and Sediment Controls. At a minimum, erosion and sediment controls must be selected, designed, installed, implemented, and maintained to: i. Minimize soil erosion through application of runoff control and soil stabilization control measure to minimize pollutant discharges; and ii. Control stormwater discharges, including both peak flow rates and total stormwater volume, to minimize channel and streambank erosion and scour in the immediate vicinity of the discharge points; and iii. Minimize the amount of soil exposed during construction activity; and iv. Minimize the disturbance of steep slope; and v. Minimize sediment discharges from the site; and vi. Provide and maintain natural buffers around surface waters, direct stormwater to vegetated areas and maximize stormwater infiltration to reduce pollutant discharges, unless infeasible; and vii. Minimize soil compaction. Minimizing soil compaction is not required 21 Part II.B.1.a.vii. where the intended function of a specific area of the site dictates that it be compacted; and viii. Unless infeasible, preserve a sufficient amount of topsoil to complete soil restoration and establish a uniform, dense vegetative cover; and ix. Minimize dust. On areas of exposed soil, minimize dust through the appropriate application of water or other dust suppression techniques to control the generation of pollutants that could be discharged from the site. b. Soil Stabilization. In areas where soil disturbance activity has ceased, whether permanently or temporarily ceased, the application of soil stabilization measures must be initiated by the end of the next business day and completed within 14 calendar days from the date the current soil disturbance activity ceased. For construction sites that directly discharge to one of the 303(d) segments listed in Appendix D, or are located in one of the watersheds listed in Appendix C, or are authorized to disturb greater than five acres in accordance with Part I.E.5.a.viii., the application of soil stabilization measures must be initiated by the end of the next business day and completed within seven calendar days from the date the soil disturbance activity ceased. c. Dewatering. Discharges from dewatering activities, including discharges from dewatering of trenches and excavations, must be managed by appropriate control measures. d. Pollution Prevention Measures. Select, design, install, implement, and maintain effective pollution prevention measures to minimize the discharge of pollutants and prevent a violation of the water quality standards. At a minimum, such measures must be selected, designed, installed, implemented, and maintained to: i. Minimize the discharge of pollutants from equipment and vehicle washing, wheel wash water, and other wash waters. Soaps, detergents and solvents cannot be used; and ii. Minimize the exposure of building materials, building products, construction wastes, trash, landscape materials, fertilizers, pesticides, herbicides, detergents, sanitary waste, hazardous and toxic waste, and other materials present on the site to precipitation 22 Part II.B.1.d.ii. and to stormwater. Minimization of exposure is not required in cases where the exposure to precipitation and to stormwater will not result in a discharge of pollutants, or where exposure of a specific material or product poses little risk of stormwater contamination (such as final products and materials intended for outdoor use); and iii. Prevent the discharge of pollutants from spills and leaks and implement chemical spill and leak prevention and response procedures. e. Surface Outlets. When discharging from basins and impoundments, the surface outlets must be designed, constructed, and maintained in such a manner that sediment does not leave the basin or impoundment and that erosion at or below the outlet does not occur. C. Post-Construction Stormwater Management Practice (SMP) Requirements 1. The owner or operator of a construction activity that requires post- construction SMPs, in accordance with Part III.C., must select, design, install, implement, and maintain the SMPs to meet the performance criteria in the New York State Stormwater Management Design Manual, dated July 31, 2024 (DM), using sound engineering judgment. Where SMPs are not designed in conformance with the performance criteria in the DM, the owner or operator must include in the SWPPP the reason(s) for the deviation or alternative design and provide information which demonstrates that the deviation or alternative design is equivalent to the technical standard. 2. The owner or operator of a construction activity, that requires SMPs in accordance with Part III.C., must design the practices to meet the applicable sizing criteria in Part II.C.2.a., b., c., or d. a. Sizing Criteria for New Development i. Runoff Reduction Volume (RRv) and Water Quality Volume (WQv): 1. Reduce the total WQv by application of RR techniques and standard SMPs with RRv capacity. The total WQv must be calculated in accordance with the criteria in Section 4.2 of the DM; or 23 Part II.C.2.a.i.2. 2. Minimum RRv and Treatment of Remaining Total WQv: Construction activities that cannot meet the requirements in Part II.C.2.a.i.1. due to site limitations must direct runoff from all newly constructed impervious areas to a RR technique or standard SMP with RRv capacity unless infeasible. The specific site limitations that prevent the reduction of 100% of the WQv must be documented in the SWPPP. For each impervious area that is not directed to a RR technique or standard SMP with RRv capacity, the SWPPP must include documentation which demonstrates that all options were considered and for each option explains why it is considered infeasible. In no case shall the runoff reduction achieved from the newly constructed impervious areas be less than the Minimum RRv as calculated using the criteria in Section 4.4 of the DM. The remaining portion of the total WQv that cannot be reduced must be treated by application of standard SMPs. ii. Channel Protection Volume (CPv): Provide 24 hour extended detention of the post-developed 1-year, 24-hour storm event, remaining after runoff reduction. Where a CPv control orifice is provided, the minimum orifice size must be 3 inches, with acceptable external trash rack or orifice protection. The CPv requirement does not apply when: 1. Reduction of the entire CPv is achieved by application of runoff reduction techniques or infiltration systems; or 2. The 1-year post-development peak discharge is less than or equal to 2.0 cfs without detention or velocity controls; or 3. The site directly discharges into a fifth order or larger water body (stream, river, or lake), or tidal waters, where the increase in smaller flows will not impact the stream bank or channel integrity. However, the point of discharge must be adequately protected against scour and erosion by the increased peak discharge. 24 Part II.C.2.a.iii. iii. Overbank Flood Control Criteria (Qp): Requires storage to attenuate the post-development 10-year, 24-hour peak discharge rate (Qp) to predevelopment rates. The Qp requirement does not apply when: 1. the site directly discharges to tidal waters or fifth order or larger streams, or 2. A downstream analysis reveals that overbank control is not required. iv. Extreme Flood Control Criteria (Qf): Requires storage to attenuate the post-development 100-year, 24-hour peak discharge rate (Qf) to predevelopment rates. The Qf requirement does not apply when: 1. the site directly discharges to tidal waters or fifth order or larger streams, or 2. A downstream analysis reveals that overbank control is not required. b. Sizing Criteria for New Development in Enhanced Phosphorus Removal Watersheds i. Runoff Reduction Volume (RRv) and Water Quality Volume (WQv): 1. Reduce the WQv by application of RR techniques and standard SMPs with RRv capacity. The total WQv is the runoff volume from the 1-year, 24-hour design storm over the post-developed watershed and must be calculated in accordance with the criteria in Section 4.3 of the DM; or 2. Minimum RRv and Treatment of Remaining Total WQv: Construction activities that cannot meet the criteria in Part II.C.2.b.i.1. due to site limitations must direct runoff from all newly constructed impervious areas to a RR technique or standard SMP with RRv capacity unless infeasible. The specific site limitations that prevent the reduction of 100% of the WQv must be documented in the SWPPP. For each impervious area that is not directed to a RR technique or standard SMP with RRv capacity, the SWPPP must include 25 Part II.C.2.b.i.2. documentation which demonstrates that all options were considered and for each option explains why it is considered infeasible. In no case shall the runoff reduction achieved from the newly constructed impervious areas be less than the Minimum RRv as calculated using the criteria in Section 4.5 of the DM. The remaining portion of the total WQv that cannot be reduced must be treated by application of standard SMPs. ii. Channel Protection Volume (CPv): Provide 24 hour extended detention of the post-developed 1-year, 24-hour storm event, remaining after runoff reduction. Where a CPv control orifice is provided, the minimum orifice size must be 3 inches, with acceptable external trash rack or orifice protection. The CPv requirement does not apply when: 1. Reduction of the entire CPv is achieved by application of runoff reduction techniques or infiltration systems; or 2. The 1-year post-development peak discharge is less than or equal to 2.0 cfs; or 3. The site directly discharges to tidal waters, or a fifth order or larger water body (stream, river, or lake) where the increase in smaller flows will not impact the stream bank or channel integrity. However, the point of discharge must be adequately protected against scour and erosion by the increased peak discharge. iii. Overbank Flood Control Criteria (Qp): Requires storage to attenuate the post-development 10-year, 24-hour peak discharge rate (Qp) to predevelopment rates. The Qp requirement does not apply when: 1. the site directly discharges to tidal waters or fifth order or larger streams; or 2. A downstream analysis reveals that overbank control is not required. 26 Part II.C.2.b.iv. iv. Extreme Flood Control Criteria (Qf): Requires storage to attenuate the post-development 100-year, 24-hour peak discharge rate (Qf) to predevelopment rates. The Qf requirement does not apply when: 1. the site directly discharges to tidal waters or fifth order or larger streams; or 2. A downstream analysis reveals that overbank control is not required. c. Sizing Criteria for Redevelopment Activity i. Water Quality Volume (WQv): The WQv treatment objective for redevelopment activity must be addressed by one of the following options, as outlined in Section 9.2.1. Redevelopment activities located in an Enhanced Phosphorus Removal Watershed (see Part III.B.3. and Appendix C) must calculate the WQv in accordance with Section 4.3 of the DM. All other redevelopment activities must calculate the WQv in accordance with Section 4.2 of the DM. 1. Reduce the existing impervious cover by a minimum of 25% of the total disturbed, impervious area. The Soil Restoration criteria in Section 5.1.6 of the DM must be applied to all newly created pervious areas; or 2. Capture and treat 100% of the required WQv, for a minimum of 25% of the disturbed redevelopment impervious area, by implementation of standard SMPs or reduced by application of runoff reduction techniques; or 3. Capture and treat 100% of the required WQv, for a minimum of 75% of the disturbed redevelopment impervious area, by implementation of a volume-based alternative SMP, as defined in Section 9.4 of the DM; or 4. Capture and treat 100% of the required WQv, for a minimum of 75% of the disturbed redevelopment impervious area, by implementation of a flow-through alternative SMP sized to treat the peak rate of runoff from the WQv design storm; or 27 Part II.C.2.c.i.5. 5. Application of a combination of 1 through 4 above that provide a weighted average of at least two of the above methods. Application of this method must be in accordance with the criteria in Section 9.2.1(A)(V) of the DM; or 6. If there is an existing SMP located on the site that captures and treats runoff from the impervious area that is being disturbed, the WQv treatment option selected must, at a minimum, provide treatment equal to the treatment that was being provided by the existing practice(s) if that treatment is greater than the treatment required by options 1 through 5 above. ii. Channel Protection Volume (CPv) is not required if there is 0% change to hydrology that increases the discharge rate and volume from the project site. iii. Overbank Flood Control (Qp) is not required if there is 0% change to hydrology that increases the discharge rate from the project site. iv. Extreme Flood Control (Qf) is not required if there is 0% change to hydrology that increases the discharge rate from the project site. d. Sizing Criteria for Combination of Redevelopment Activity and New Development Construction projects, that include both new development and redevelopment activity, must use SMPs that meet the sizing criteria calculated as an aggregate of the sizing criteria in Part II.C.2.a. or b. for the new development portion of the project and Part II.C.2.c. for the redevelopment activity portion of the project. Part III. Stormwater Pollution Prevention Plan (SWPPP) A. General SWPPP Requirements 1. A SWPPP must be prepared and implemented by the owner or operator of all construction activity covered by this permit. All authorized discharges must be identified in the SWPPP. The SWPPP must document the selection, design, installation, implementation and maintenance of the control measures and 28 Part III.A.1. practices that will be used to meet the effluent limitations in Part II.B. and, where applicable, the SMP requirements in Part II.C. 2. The SWPPP must demonstrate consideration in narrative format of the future physical risks due to climate change pursuant to the Community Risk and Resiliency Act (CRRA), 6 NYCRR Part 490, and associated guidance. a. The owner or operator must consider: i. the following physical risks due to climate change: (i) increasing temperature; and (ii) increasing precipitation; and (iii) increasing variability in precipitation, including chance of drought; and (iv) increasing frequency and severity of flooding; and (v) rising sea level; and (vi) increasing storm surge; and (vii) shifting ecology. ii. for each of the following: (i) overall site planning; and (ii) location, elevation, and sizing of: a. control measures and practices; and b. conveyance system(s); and c. detention system(s). 3. The SWPPP must describe the erosion and sediment control practices and where required, SMPs that will be used and/or constructed to reduce the pollutants in stormwater discharges and to assure compliance with the 29 Part III.A.3. requirements of this permit. In addition, the SWPPP must identify potential sources of pollution which may reasonably be expected to affect the quality of stormwater discharges. 4. All SWPPPs, that require the SMP component in accordance with Part III.B.2., must be prepared by a qualified professional. 5. The owner or operator must keep the SWPPP current so that, at all times, it accurately documents the erosion and sediment control practices that are being used or will be used during construction, and all SMPs that will be constructed on the site. At a minimum, the owner or operator must modify the SWPPP, including construction drawings: a. whenever the current provisions prove to be ineffective in minimizing pollutants in stormwater discharges from the site; and b. whenever there is a change in design, construction, or operation at the construction site that has or could have an effect on the discharge of pollutants; and c. to address issues or deficiencies identified during an inspection by the qualified inspector, NYSDEC, or other regulatory authority; and d. to document the final construction conditions in an as-built drawing. 6. NYSDEC may notify the owner or operator at any time that the SWPPP does not meet one or more of the minimum requirements of this permit. The notification must be in writing and identify the provisions of the SWPPP that require modification. Within fourteen (14) calendar days of such notification, or as otherwise indicated by NYSDEC, the owner or operator must make the required changes to the SWPPP and submit written notification to NYSDEC that the changes have been made. If the owner or operator does not respond to NYSDEC’s comments in the specified time frame, NYSDEC may suspend the owner’s or operator’s coverage under this permit or require the owner or operator to obtain coverage under an individual SPDES permit in accordance with Part II.D.4. 7. Prior to the commencement of construction activity, the owner or operator must identify the contractor(s) and subcontractor(s) that will be responsible for installing, constructing, repairing, replacing, inspecting, and maintaining the erosion and sediment control practices included in the SWPPP and the 30 Part III.A.7. contractor(s) and subcontractor(s) that will be responsible for constructing the SMPs included in the SWPPP. The owner or operator must have each of the contractors and subcontractors identify at least one person from their company to be trained contractor that will be responsible for implementation of the SWPPP. The owner or operator must ensure that at least one trained contractor is on site daily when soil disturbance activities are being performed. The owner or operator must have each of the contractors and subcontractors identified above sign a copy of the following certification statement below before the commencement of construction activities: "I hereby certify under penalty of law that I understand and agree to comply with the requirements of the SWPPP and agree to implement any corrective actions identified by the qualified inspector during a site inspection. I also understand that the owner or operator must comply with the requirements of the most current version of the New York State Pollutant Discharge Elimination System (SPDES) Construction General Permit (CGP) for Stormwater Discharges from Construction Activities and that it is unlawful for any person to cause or contribute to a violation of water quality standards. Furthermore, I am aware that there are significant penalties for submitting false information, that I do not believe to be true, including the possibility of fine and imprisonment for knowing violations" In addition to providing the certification statement above, the certification page must also identify the specific elements of the SWPPP that each contractor and subcontractor will be responsible for and include the name and title of the person providing the signature; the name and title of the trained contractor responsible for SWPPP implementation; the name, address and telephone number of the contracting firm; the address (or other identifying description) of the site; and the date the certification statement is signed. The owner or operator must attach the certification statement(s) to the copy of the SWPPP that is maintained at the construction site. If new or additional contractors are hired to implement measures identified in the SWPPP after the commencement of construction activities, they must also sign the certification statement and provide the information listed above prior to performing construction activities. 31 Part III.B. B. Required SWPPP Contents 1. Erosion and sediment control component - The owner or operator must prepare a SWPPP that includes erosion and sediment control practices. a. Erosion and sediment control practices must be designed: i. in conformance with the BB; or ii. equivalent to the BB if deviating from Part III.B.1.a.i. b. If the erosion and sediment control practices are designed in conformance with Part III.B.1.a.ii., the SWPPP must include a demonstration of equivalence to the BB. c. At a minimum, the erosion and sediment control component of the SWPPP must include the following: i. Background information about the scope of the project, including the location, type and size of project; and ii. A site map/construction drawing(s) with north arrows for the project, including a general location map. At a minimum, the site map must show the total site area; all improvements; areas of disturbance; areas that will not be disturbed; existing vegetation; on-site and adjacent off-site surface water(s); floodplain/floodway boundaries; wetlands and drainage patterns that could be affected by the construction activity; existing and final contours; locations of different soil types with boundaries; material, waste, borrow or equipment storage areas located on adjacent properties; and location(s) of the stormwater discharge(s) and receiving surface water(s); and iii. A description of the soil(s) present at the site, including an identification of the Hydrologic Soil Group (HSG); and iv. A phasing plan for the project and sequencing plans for all phases, both of which must address clearing and grubbing, excavation and grading, utility and infrastructure installation, final stabilization, 32 Part III.B.1.c.iv. and any other construction activity at the site that will result in soil disturbance. 1. The phasing plan must include: a. a map delineating and labeling the limits of soil disturbance for all phases of a project; and b. a table identifying the order and intended schedule of when each phase will begin and end its sequencing plan. The table must identify the total disturbed area for each phase at any one time and the total disturbed area for the overall project at any one time all on one timeline showing all overlapping quantities of disturbed area at any one time; and 2. A sequencing plan for a specific phase must include: a. a table indicating the order and intended schedule of construction activities within a phase, and corresponding construction drawings with a description of the work to be performed; and b. all permanent and temporary stabilization measures; and v. A description of the minimum erosion and sediment control practices to be installed or implemented for each construction activity that will result in soil disturbance. Include a schedule that identifies the timing of initial placement or implementation of each erosion and sediment control practice and the minimum time frames that each practice should remain in place or be implemented; and vi. A site map/construction drawing(s) showing the specific location(s), size(s), and length(s) of each erosion and sediment control practice; and vii. The dimensions, material specifications, installation details, and operation and maintenance requirements for all erosion and sediment control practices. Include the location and sizing of any 33 Part III.B.1.c.vii. temporary sediment basins and structural practices that will be used to divert flows from exposed soils; and viii. A maintenance inspection schedule for the contractor(s) and subcontractor(s) identified in Part III.A.7. to ensure continuous and effective operation of the erosion and sediment control practices. The maintenance inspection schedule must be in accordance with the requirements in the BB technical standard; and ix. A description of the pollution prevention measures that will be used to control litter, construction chemicals and construction debris from becoming a pollutant source in the stormwater discharges; and x. A description and location of any stormwater discharges associated with industrial activity other than construction at the site, including, but not limited to, stormwater discharges from asphalt plants and concrete plants located on the construction site; and xi. Identification of any elements of the design that are not in conformance with the design criteria in the BB technical standard. Include the reason for the deviation or alternative design and provide information which demonstrates that the deviation or alternative design is equivalent to the technical standard. 2. SMP component – The owner or operator of construction activity identified in Table 2 of Appendix B must prepare a SWPPP that includes SMPs. a. SMPs must be designed in conformance with the applicable sizing criteria in Part II.C.2.a., c., or d.; and b. SMPs must be designed in conformance with the performance criteria: i. in the DM; or ii. equivalent to the DM if deviating from Part III.B.2.b.i.; or iii. in the New York State Stormwater Management Design Manual, dated January 2015 (2015 Design Manual), or equivalent to it, if the following criteria are met: 34 Part III.B.2.b.iii.1. 1. The eNOI is submitted in accordance with Part I.D. before January 29, 2027 for construction activities that are either: a. subject to governmental review and approval: i. where the owner or operator made any application to that governmental entity prior to the effective date of this permit; and ii. such application included a SWPPP developed using the 2015 Design Manual or equivalent to it; or b. not subject to governmental review and approval: i. where a fiscal allocation for the construction activities has been developed and approved by a governmental entity; and ii. the SWPPP was developed using the 2015 Design Manual or equivalent to it; and c. If SMPs are designed in conformance with Part III.B.2.b.ii., the SWPPP must include the reason(s) for the deviation or alternative design and a demonstration of equivalence to the DM; and d. If SMPs are designed in conformance with Part III.B.2.b.iii., the SWPPP must include supporting information or documentation demonstrating that Part III.B.2.b.iii.1.a. or b. apply; and e. The SMP component of the SWPPP must include the following: i. Identification of all SMPs to be constructed as part of the project, including which option the SMP designs conform to, either Part III.B.2.b.i., ii., or iii. Include the dimensions, material specifications and installation details for each SMP; and ii. A site map/construction drawing(s) showing the specific location and size of each SMP; and 35 Part III.B.2.e.iii. iii. A Stormwater Modeling and Analysis Report that includes: (i) Map(s) showing pre-development conditions, including watershed/subcatchments boundaries, flow paths/routing, and design points; and (ii) Map(s) showing post-development conditions, including watershed/subcatchments boundaries, flow paths/routing, design points and SMPs; and (iii) Results of stormwater modeling (i.e. hydrology and hydraulic analysis) for the required storm events. Include supporting calculations (model runs), methodology, and a summary table that compares pre- and post-development runoff rates and volumes for the different storm events; and (iv) Summary table, with supporting calculations, which demonstrates that each SMP has been designed in conformance with the sizing criteria included in the DM; and (v) Identification of any sizing criteria that is not required based on the requirements included in Part II.C.; and (vi) Identification of any elements of the design that are not in conformance with the performance criteria in the DM. Include the reason(s) for the deviation or alternative design and provide information which demonstrates that the deviation or alternative design is equivalent to the DM. iv. Soil testing results and locations (test pits, borings); and v. Infiltration test results, when required in accordance with Part III.B.2.a.; and vi. An operations and maintenance plan that includes inspection and maintenance schedules and actions to ensure continuous and effective operation of each SMP. The plan must identify the entity 36 Part III.B.2.e.vi. that will be responsible for the long-term operation and maintenance of each practice; and 3. Enhanced Phosphorus Removal Standards - The owner or operator of construction activity identified in Table 2 of Appendix B that is located in a watershed identified in Appendix C must prepare a SWPPP that includes SMPs designed in conformance with the applicable sizing criteria in Part II.C.2.b., c., or d. and the performance criteria Enhanced Phosphorus Removal Standards included in the DM. At a minimum, the SMP component of the SWPPP must meet the requirements of Part III.B.2. C. Required SWPPP Components by Project Type Owners or operators of construction activities, identified in Table 1 of Appendix B, are required to prepare a SWPPP that only includes erosion and sediment control practices designed in accordance with Part III.B.1. Owners or operators of the construction activities, identified in Table 2 of Appendix B, must prepare a SWPPP that also includes SMPs designed in accordance with Part III.B.2 or 3. For the entire area of disturbance, including the entire common plan of development or sale if applicable, the owner or operator must evaluate every bullet from Appendix B Table 1 and Table 2 separately. If bullets from both Table 1 and Table 2 apply, the SWPPP must include erosion and sediment control practices for all construction activities but SMPs for only those portions of the construction activities that fall under Table 2 bullet(s). Part IV. Inspection and Maintenance Requirements A. General Construction Site Inspection and Maintenance Requirements 1. The owner or operator must ensure that all erosion and sediment control practices (including pollution prevention measures), and all SMPs identified in the SWPPP, are inspected and maintained in accordance with Part IV.B. and C. B. Contractor Maintenance Inspection Requirements 1. The owner or operator of each construction activity, identified in Tables 1 and 2 of Appendix B, must have a trained contractor inspect the erosion and sediment control practices and pollution prevention measures being 37 Part IV.B.1. implemented within the active work area daily to ensure that they are being maintained in effective operating condition at all times. If deficiencies are identified, the contractor must: a. if the corrective action does not require engineering design: i. begin implementing corrective actions within one business day; and ii. complete the corrective actions within five business days; or b. if the corrective action requires engineering design: i. begin the engineering design process within five business days; and ii. complete the corrective action in a reasonable time frame but no later than within 60 calendar days. 2. For construction sites where soil disturbance activities have been temporarily suspended (e.g. winter shutdown) and temporary stabilization measures have been applied to all disturbed areas, the trained contractor can stop conducting the maintenance inspections in accordance with Part IV.B.1. The trained contractor must begin conducting the maintenance inspections in accordance with Part IV.B.1. as soon as soil disturbance activities resume. 3. For construction sites where soil disturbance activities have been shut down with partial project completion, the trained contractor can stop conducting the maintenance inspections in accordance with Part IV.B.1. if all areas disturbed as of the project shutdown date have achieved final stabilization and all SMPs required for the completed portion of the project have been constructed in conformance with the SWPPP and are operational. C. Qualified Inspector Inspection Requirements 1. With the exception of the following construction activities identified in Tables 1 and 2 of Appendix B, a qualified inspector must conduct site inspections for all other construction activities identified in Tables 1 and 2 of Appendix B: a. the construction of a single-family residential subdivision with 25% or less impervious cover at total site build-out that involves a soil disturbance of one (1) or more acres of land but less than or equal to five (5) acres and is 38 Part IV.C.1.a. not located in one of the watersheds listed in Appendix C and not directly discharging to one of the 303(d) segments listed in Appendix D; and b. the construction of a single-family home that involves soil disturbances of one (1) or more acres but less than or equal to five (5) acres and is not located in one of the watersheds listed in Appendix C and not directly discharging to one of the 303(d) segments listed in Appendix D; and c. construction on agricultural property that involves soil disturbances of one (1) or more acres but less than five (5) acres; and d. construction activities located in the New York City Watershed located east of the Hudson River, see Appendix C Figure 1, that involve soil disturbances of 5,000 square feet or more, but less than one acre. 2. The qualified inspector must conduct site inspections in accordance with the following timetable: a. For construction sites where soil disturbance activities are on-going, the qualified inspector must conduct a site inspection at least once every seven (7) calendar days; or b. For construction sites where soil disturbance activities are on-going and the owner or operator has received authorization in accordance with Part I.E.6. to disturb greater than five (5) acres of soil at any one time, the qualified inspector must conduct at least two (2) site inspections every seven (7) calendar days. The two (2) inspections must be separated by a minimum of two (2) full calendar days; or c. For construction sites where soil disturbance activities have been temporarily suspended (e.g. winter shutdown) and temporary stabilization measures have been applied to all disturbed areas, the qualified inspector must conduct a site inspection at least once every thirty (30) calendar days. The owner or operator must notify the DOW Water (SPDES) Program contact at the Regional Office (see contact information in Appendix E) or, in areas under the jurisdiction of a Traditional Land Use Control MS4 Operator, the Traditional Land Use Control MS4 Operator (provided the Traditional Land Use Control MS4 Operator is not the owner or operator of the construction activity) by hard copy or email prior to reducing the inspections to this frequency and again by hard copy or email prior to re-commencing construction; or 39 Part IV.C.2.d. d. For construction sites where soil disturbance activities have been shut down with partial project completion, the requirement to have the qualified inspector conduct inspections ceases if all areas disturbed as of the project shutdown date have achieved final stabilization and all SMPs required for the completed portion of the project have been constructed in conformance with the SWPPP and are operational. The owner or operator must notify the DOW Water (SPDES) Program contact at the Regional Office (see contact information in Appendix E) or, in areas subject to the review authority of Traditional Land Use Control MS4 Operator(s) in accordance with Part I.D.2.b.ii.1., the Traditional Land Use Control MS4 Operator(s) (provided the Traditional Land Use Control MS4 Operator(s) are not the owners or operators of the construction activity) in writing prior to the shutdown and again in writing prior to resuming construction activity. If soil disturbance activities are not resumed within 2 years from the date of shutdown, the owner or operator must terminate coverage by meeting the requirements of Part V; or e. For construction sites involving soil disturbance of one (1) or more acres that directly discharge to one of the 303(d) segments listed in Appendix D or is located in one of the watersheds listed in Appendix C, the qualified inspector must conduct at least two (2) site inspections every seven (7) calendar days. The two (2) inspections must be separated by a minimum of two (2) full calendar days. 3. At a minimum, the qualified inspector must inspect: a. all erosion and sediment control practices and pollution prevention measures to ensure integrity and effectiveness; and b. all SMPs under construction to ensure that they are constructed in conformance with the SWPPP; and c. all areas of disturbance that have not achieved final stabilization; and d. all points of discharge to surface waters of the State located within, or immediately adjacent to, the property boundaries of the construction site; and e. all points of discharge from the construction site. 40 Part IV.C.4. 4. The qualified inspector must prepare an inspection report subsequent to each and every inspection. At a minimum, the inspection report must include and/or address all of the following, for all construction activities except those listed in Part IV.C.1.: a. Permit identification number; and b. Date and time of inspection; and c. Name and title of person(s) performing inspection; and d. A description of the weather and soil conditions (e.g. dry, wet, saturated) at the time of the inspection, including the temperature at the time of the inspection; and e. A description of the condition of the runoff at all points of discharge from the construction site. This must include identification of any discharges of sediment from the construction site. Include discharges from conveyance systems (i.e. pipes, culverts, ditches, etc.) and overland flow; and f. A description of the condition of all surface waters of the State located within, or immediately adjacent to, the property boundaries of the construction site which receive runoff from disturbed areas. This must include identification of any discharges of sediment to the surface waters of the State; and g. Identification of all erosion and sediment control practices and pollution prevention measures that need repair or maintenance; and h. Identification of all erosion and sediment control practices and pollution prevention measures that were not installed properly or are not functioning as designed and need to be reinstalled or replaced; and i. Description and sketch (map) of areas with active soil disturbance activity, areas that have been disturbed but are inactive at the time of the inspection, and areas that have been stabilized (temporary and/or final) since the last inspection; and j. Estimates, in square feet or acres, of the following areas: 41 Part IV.C.4.j.i. i. Total area with active soil disturbance (not requiring either temporary stabilization or final stabilization); and ii. Total area with inactive soil disturbance (requiring either temporary stabilization or final stabilization); and iii. Total area that has achieved temporary stabilization; and iv. Total area that has achieved final stabilization; and k. Current stage of construction of all SMPs and identification of all construction activity on site that is not in conformance with the SWPPP and technical standards; and l. Corrective action(s) that must be taken to install, repair, replace or maintain erosion and sediment control practices and pollution prevention measures; and to correct deficiencies identified with the construction of the SMP(s); and m. Identification and status of all corrective actions that were required by previous inspection; and n. Digital photographs, with date stamp, that clearly show the condition of all practices that have been identified as needing corrective actions. The qualified inspector must attach color copies of the digital photographs to the inspection report being maintained onsite within seven (7) calendar days of the date of the inspection. The qualified inspector must also take digital photographs, with date stamp, that clearly show the condition of the practice(s) after the corrective action has been completed. The qualified inspector must attach paper color copies of the digital photographs to the inspection report that documents the completion of the corrective action work within seven (7) calendar days of that inspection. 5. Within one business day of the completion of an inspection, the qualified inspector must notify the owner or operator, and appropriate contractor or subcontractor identified in Part III.A.7., of any corrective actions that need to be taken. The contractor or subcontractor must: a. if the corrective action does not require engineering design: 42 Part IV.C.5.a.i. i. begin implementing corrective actions within one business day; and ii. complete the corrective actions within five business days; or b. if the corrective action requires engineering design: i. begin the engineering design process within five business days; and ii. complete the corrective action in a reasonable time frame but no later than within 60 calendar days. 6. All inspection reports must be signed by the qualified inspector. In accordance with Part I.E.3., the inspection reports must be maintained on site with the SWPPP. Part V. How to Terminate CGP Coverage A. Electronic Notice of Termination (eNOT) Submittal The eNOT contains questions to ensure requirements in Part V.A. have been met. 1. An owner or operator must terminate coverage when one or more of the following requirements have been met: a. Total project completion: i. all construction activity identified in the SWPPP has been completed; and ii. all areas of disturbance have achieved final stabilization; and iii. all temporary, structural erosion and sediment control measures have been removed; and iv. all SMPs have been constructed in conformance with the SWPPP and are operational; and v. an as-built drawing has been prepared; or 43 Part V.A.1.b. b. Planned shutdown with partial project completion: i. all soil disturbance activities have ceased; and ii. all areas disturbed as of the project shutdown date have achieved final stabilization; and iii. all temporary, structural erosion and sediment control measures have been removed; and iv. all SMPs required for the completed portion of the project have been constructed in conformance with the SWPPP and are operational; and v. an as-built drawing has been prepared; or c. In accordance with Part I.G. Change of Owner or Operator; or d. The owner or operator has obtained coverage under an alternative general SPDES permit or an individual SPDES permit. 2. For construction activities that require qualified inspector inspections in accordance with Part IV.C.1. and have met Part V.A.1.a. or b., the owner or operator must have the qualified inspector perform a final site inspection prior to submitting the eNOT. The qualified inspector must, by signing the “Final Stabilization” and “Post-Construction Stormwater Management Practice(s)” certification statements on the eNOT, certify that all the requirements in Part V.A.1.a. or b. have been achieved. 3. For construction activities that are subject to the review authority of Traditional Land Use Control MS4 Operator(s) in accordance with Part I.D.2.b.ii.1. and meet Part V.A.1.a. or b., the owner or operator must have the Traditional Land Use Control MS4 Operator(s) sign the “MS4 Acceptance” statement on the eNOT in accordance with the requirements in Part VII.J. A Traditional Land Use Control MS4 Operator official, by signing this statement, determined that it is acceptable for the owner or operator to submit the eNOT in accordance with the requirements of this Part. A Traditional Land Use Control MS4 Operator can make this determination by performing a final site inspection themselves or by accepting the qualified inspector’s final site inspection certification(s) when required in Part V.A.2. 44 Part V.A.4. 4. For construction activities that require SMPs and meet Part V.A.1.a. or b., the owner or operator must, prior to submitting the eNOT, ensure one of the following: a. for SMP(s) that were constructed by a private entity, but will be owned, operated, and maintained by a public entity, the SMP(s) and any right-of- way(s) needed to operate and maintain such practice(s) have been deeded to the municipality in which the practice(s) is located; or b. for SMP(s) that are privately owned, but will be operated and maintained by a public entity, an executed operation and maintenance agreement is in place with the municipality that will operate and maintain the SMP(s); or c. for SMP(s) that are privately owned, the owner or operator has a mechanism in place that requires operation and maintenance of the practice(s) in accordance with the operation and maintenance plan, such as a deed covenant in the owner or operator’s deed of record; or d. for SMP(s) that are owned by a public or private institution (e.g. school, university, hospital), government agency or authority, or public utility, the owner or operator has policies and procedures in place that ensure operation and maintenance of the practices in accordance with the operation and maintenance plan. 5. An owner or operator that has met the requirements of Part V.A.1., 2., 3., and 4. must request termination of coverage under this permit by submitting a complete Notice of Termination form electronically using a NYSDEC approved form.5 a. The owner’s or operator’s coverage is terminated as of the termination date indicated in the Letter of Termination (LOT), which is sent by NYSDEC after a complete eNOT is submitted. 5 Unless NYSDEC grants a waiver in accordance with 40 CFR 127.15(c) or (d). All waiver requests must be submitted to Stormwater_info@dec.ny.gov or NYSDEC, Bureau of Water Permits, 625 Broadway, 4th Floor, Albany, New York 12233-3505. 45 Part VI. Part VI. Record Retention and Reporting A. Record Retention The owner or operator must retain a copy of the documents listed in Part I.E.3. and a copy of the LOT for a period of at least five years from the date that NYSDEC accepts a complete NOT submitted in accordance with Part V. B. Reporting Except for the eNOI, the signature forms associated with the eNOI, and the eNOT, all other written correspondence requested by NYSDEC, including individual permit applications, must be sent to the address of the appropriate DOW (SPDES) Program contact at the Regional Office listed in Appendix E. Part VII. Standard Permit Requirements For the purposes of this permit, examples of contractors and subcontractors include: third-party maintenance and construction contractors. A. Duty to Comply The owner or operator, and all contractors or subcontractors, must comply with all requirements of this permit. Any non-compliance with the requirements of this permit constitutes a violation of the New York State Environmental Conservation Law (ECL), and its implementing regulations, and is grounds for enforcement action. Filing of a request for termination of coverage under this permit, or a notification of planned changes or anticipated non-compliance, does not limit, diminish or stay compliance with any requirements of this permit. B. Need to Halt or Reduce Activity Not a Defense The necessity to halt or reduce the construction activity regulated by this permit, in order to maintain compliance with the requirements of this permit, must not be a defense in an enforcement action. C. Penalties There are substantial criminal, civil, and administrative penalties associated with violating the requirements of this permit. Fines of up to $37,500 per day for each 46 Part VII.C. violation and imprisonment for up to 15 years may be assessed depending upon the nature and degree of the offense. D. False Statements Any person who knowingly makes any false material statement, representation, or certification in any application, record, report, or other document filed or required to be maintained under this permit, including monitoring reports or reports of compliance or noncompliance must, upon conviction, be punished in accordance with ECL §71-1933 and or New York State Penal Law Articles 175 and 210. E. Re-Opener Clause Upon issuance of this permit, a determination has been made on the basis of a submitted Notice of Intent, plans, or other available information, that compliance with the specified permit requirements will reasonably protect classified water use and assure compliance with applicable water quality standards. Satisfaction of the requirements of this permit notwithstanding, if operation pursuant to this permit causes or contributes to a condition in contravention of State water quality standards or guidance values, or if NYSDEC determines that a modification is necessary to prevent impairment of the best use of the waters or to assure maintenance of water quality standards or compliance with other provisions of ECL Article 17 or the Clean Water Act (CWA), or any regulations adopted pursuant thereto, NYSDEC may require such modification and the Commissioner may require abatement action to be taken by the owner or operator and may also prohibit such operation until the modification has been implemented. F. Duty to Mitigate The owner or operator, and its contractors and subcontractors, must take all reasonable steps to minimize or prevent any discharge in violation of this permit which has a reasonable likelihood of adversely affecting human health or the environment. G. Requiring Another General Permit or Individual SPDES Permit NYSDEC may require any owner or operator authorized to discharge in accordance with this permit to apply for and obtain an individual SPDES permit or apply for authorization to discharge in accordance with another general SPDES permit. 1. Cases where an individual SPDES permit or authorization to discharge in accordance with another general SPDES permit may be required include, but is not limited to the following: 47 Part VII.G.1.a. a. the owner or operator is not in compliance with the conditions of this permit or does not meet the requirements for coverage under this permit; and b. a change has occurred in the availability of demonstrated technology or practices for the control or abatement of pollutants applicable to the point source; and c. new effluent limitation guidelines or new source performance standards are promulgated that are applicable to point sources authorized to discharge in accordance with this permit; and d. existing effluent limitation guidelines or new source performance standards that are applicable to point sources authorized to discharge in accordance with this permit are modified; and e. a water quality management plan containing requirements applicable to such point sources is approved by NYSDEC; and f. circumstances have changed since the time of the request to be covered so that the owner or operator is no longer appropriately controlled under this permit, or either a temporary or permanent reduction or elimination of the authorized discharge is necessary; and g. the discharge is in violation of section 17-0501 of the ECL; and h. the discharge(s) is a significant contributor of pollutants. In making this determination, NYSDEC may consider the following factors: i. the location of the discharge(s) with respect to surface waters of the State; and ii. the size of the discharge(s); and iii. the quantity and nature of the pollutants discharged to surface waters of the State; and iv. other relevant factors including compliance with other provisions of ECL Article 17, or the CWA. 2. When NYSDEC requires any owner or operator authorized by this permit to apply for an individual SPDES permit as provided for in this subdivision, it must notify the owner or operator in writing that a permit application is required. This notice must include a brief statement of the reasons for this decision, an application 48 Part VII.G.2. form, a statement setting a time for the owner or operator to file the application for an individual SPDES permit, and a deadline, not sooner than 180 days from the owner’s or operator's receipt of the notification letter, whereby the authorization to discharge under this permit must be terminated. NYSDEC may grant additional time upon demonstration, to the satisfaction of the RWE,6 that additional time to apply for an alternative authorization is necessary or where NYSDEC has not provided a permit determination in accordance with 6 NYCRR Part 621. 3. When an individual SPDES permit is issued to an owner or operator authorized to discharge under this permit for the same discharge(s), this permit authorization for construction activities authorized under the individual SPDES permit is automatically terminated on the effective date of the individual SPDES permit unless termination is earlier in accordance with 6 NYCRR Part 750. H. Duty to Provide Information The owner or operator must furnish to NYSDEC, within five business days, unless otherwise set forth by NYSDEC, any information that NYSDEC may request to determine whether cause exists to determine compliance with this permit or to determine whether cause exists for requiring an individual SPDES permit in accordance with 6 NYCRR 750-1.21(e) (see Part VII.G. Requiring Another General Permit or Individual Permit). The owner or operator must make available to NYSDEC, for inspection and copying, or furnish to NYSDEC within 25 business days of receipt of a NYSDEC request for such information, any information retained in accordance with this permit. Except for Part I.D.4. and 5. and Part I.G., the following applies: where the owner or operator becomes aware that it failed to submit any relevant facts on the Notice of Intent, or submitted incorrect information in a Notice of Intent or in any report to NYSDEC, the owner or operator must submit such facts or corrected information to NYSDEC within five business days. I. Extension In the event a new permit is not issued and effective prior to the expiration of this permit, and this permit is extended pursuant to the State Administrative Procedure Act and 6 NYCRR Part 621, then the owner or operator with coverage under this permit may continue to operate and discharge in accordance with the requirements of this permit until a new permit is issued and effective. 6 The Regional Water Manager where a DEC Region does not have a RWE. 49 Part VII.J. J. Signatories and Certification The Notice of Intent, Notice of Termination, and reports required by this permit must be signed as provided in 40 CFR §122.22. 1. All Notices of Intent and Notices of Termination must be signed as follows: a. For a corporation. By a responsible corporate officer. For the purpose of this section, a responsible corporate officer means: (i) a president, secretary, treasurer, or vice-president of the corporation in charge of a principal business function, or any other person who performs similar policy- or decision-making functions for the corporation; or (ii) the manager of one or more manufacturing, production or operating facilities, provided, the manager is authorized to make management decisions which govern the operation of the regulated facility including having the explicit or implicit duty of making major capital investment recommendations, and initiating and directing other comprehensive measures to assure long term environmental compliance with environmental laws and regulations; the manager can ensure that the necessary systems are established or actions taken to gather complete and accurate information for Notice of Intent or Notice of Termination requirements; and where authority to sign documents has been assigned or delegated to the manager in accordance with corporate procedures. Note: NYSDEC does not require specific assignments or delegations of authority to responsible corporate officers identified in 40 CFR §122.22(a)(1)(i). NYSDEC will presume that these responsible corporate officers have the requisite authority to sign the Notice of Intent or Notice of Termination unless the corporation has notified NYSDEC to the contrary. Corporate procedures governing authority to sign a Notice of Intent or Notice of Termination may provide for assignment or delegation to applicable corporate positions under 40 CFR §122.22(a)(1)(ii) rather than to specific individuals. b. For a partnership or sole proprietorship. By a general partner or the proprietor, respectively. 50 Part VII.J.1.c. c. For a municipality, State, Federal, or other public agency. By either a principal executive officer or ranking elected official. For purposes of this section, a principal executive officer of a Federal agency includes: 1. the chief executive officer of the agency; or 2. a senior executive officer having responsibility for the overall operations of a principal geographic unit of the agency (e.g., Regional Administrators of EPA). 2. All reports required by this permit, and other information requested by NYSDEC, must be signed by a person described in Part VII.J.1., or by a duly authorized representative of that person. A person is a duly authorized representative only if: a. The authorization is made in writing by a person described in Part VII.J.1. or using the Duly Authorized Form, found on the DEC website; and b. The authorization specifies either an individual or a position having responsibility for the overall operation of the regulated facility or activity, position of equivalent responsibility, or an individual or position having overall responsibility for environmental matters for the company. (A duly authorized representative may thus be either a named individual or any individual occupying a named position); and c. The written authorization is submitted to NYSDEC. 3. Changes to authorization. If an authorization under Part VII.J.2. is no longer accurate because a different individual or position has responsibility for the overall operation of the construction activity, a new authorization satisfying the requirements of Part VII.J.2. must be submitted to NYSDEC prior to or together with any reports, information, or applications to be signed by an authorized representative. 4. Certification. Any person signing a document under Part VII.J.1. or 2. must make the following certification: I certify under penalty of law that this document and all attachments were prepared under my direction or supervision in accordance with a system designed to assure that qualified personnel properly gather and evaluate the information submitted. Based on my inquiry of the person or persons who 51 Part VII.J.4. manage the system, or those persons directly responsible for gathering the information, the information submitted is, to the best of my knowledge and belief, true, accurate, and complete. I am aware that there are significant penalties for submitting false information, including the possibility of fine and imprisonment for knowing violations. 5. Electronic reporting. If documents described in Part VII.J.1. or 2. are submitted electronically by or on behalf of the construction activity with coverage under this permit, any person providing the electronic signature for such documents must meet all relevant requirements of this section, and must ensure that all of the relevant requirements of 40 CFR Part 3 (including, in all cases, subpart D to Part 3) (Cross-Media Electronic Reporting) and 40 CFR Part 127 (NPDES Electronic Reporting Requirements) are met for that submission. K. Inspection and Entry The owner or operator must allow NYSDEC, the USEPA Regional Administrator, the applicable county health department, or any authorized representatives of those entities, or, in the case of a construction site which discharges through an MS4, an authorized representative of the MS4 receiving the discharge, upon the presentation of credentials and other documents as may be required by law, to: 1. enter upon the owner’s or operator's premises where a regulated facility or activity is located or conducted or where records must be kept under the requirements of this permit; and 2. have access to and copy at reasonable times, any records that must be kept under the requirements of this permit, including records required to be maintained for purposes of operation and maintenance; and 3. inspect at reasonable times any facilities, equipment (including monitoring and control equipment), practices or operations regulated or required under this permit; and 4. sample or monitor at reasonable times, for the purposes of assuring general SPDES permit compliance or as otherwise authorized by the CWA or ECL, any substances or parameters at any location; and 5. enter upon the property of any contributor to the regulated facility or activity under authority of the owner or operator. 52 Part VII.L. L. Confidentiality of Information The following must not be held confidential: this permit, the fact sheet for this permit, the name and address of any owner or operator, effluent data, the Notice of Intent, and information regarding the need to obtain an individual permit or an alternative general SPDES permit. This includes information submitted on forms themselves and any attachments used to supply information required by the forms (except information submitted on usage of substances). Upon the request of the owner or operator, NYSDEC must make determinations of confidentiality in accordance with 6 NYCRR Part 616, except as set forth in the previous sentence. Any information accorded confidential status must be disclosed to the Regional Administrator upon his or her written request. Prior to disclosing such information to the Regional Administrator, NYSDEC will notify the Regional Administrator of the confidential status of such information. M. Other Permits May Be Required Nothing in this permit relieves the owner or operator from a requirement to obtain any other permits required by law. N. NYSDEC Orders or Civil Decrees/Judgments The issuance of this permit by the NYSDEC, and the coverage under this permit by the owner or operator, does not supersede, revoke, or rescind any existing order on consent or civil Decree/Judgment, or modification to any such documents or to any order issued by the Commissioner, or any of the terms, conditions, or requirements contained in such order or modification therefore, unless expressly noted. O. Property Rights Coverage under this permit does not convey anypropertyrightsin either real or personal property, or any exclusive privileges, nor does it authorize any injury to private property or any invasion of personal rights, nor any infringement of Federal, State, or local laws or regulations, nor does it obviate the necessity of obtaining the assent of any other jurisdiction as required by law for the discharge authorized. P. Compliance with Interstate Standards If the construction activity covered by this permit originates within the jurisdiction of an interstate water pollution control agency, then the construction activity must also comply with any applicable effluent standards or water quality standards promulgated by that interstate agency and as set forth in this permit for such construction activities. 53 Part VII.Q. Q. Oil and Hazardous Substance Liability Coverage under this permit does not affect the imposition of responsibilities upon, or the institution of any legal action against, the owner or operator under section 311 of the CWA, which must be in conformance with regulations promulgated pursuant to section 311 governing the applicability of section 311 of the CWA to discharges from facilities with NPDES permits, nor must such issuance preclude the institution of any legal action or relieve the owner or operator from any responsibilities, liabilities, or penalties to which the owner or operator is or may be subject pursuant to the Comprehensive Environmental Response, Compensation and Liability Act of 1980, 42 U.S.C. section 9601 et seq. (CERCLA). R. Severability The provisions of this permit are severable, and if any provision of this permit, or the application of any provision of this permit to any circumstance, is held invalid, the application of such provision to other circumstances, and the remainder of this permit, must not be affected thereby. S. NYSDEC Approved Forms The owner or operator must provide all relevant information that is requested by NYSDEC, and required by this permit, on all NYSDEC approved forms. 54 Appendix A APPENDIX A – Abbreviations and Definitions Abbreviations APO – Agency Preservation Officer BB – New York State Standards and Specifications for Erosion and Sediment Control (Blue Book), dated November 2016 BMP – Best Management Practice CPESC – Certified Professional in Erosion and Sediment Control CPv – Channel Protection Volume CWA – Clean Water Act (or the Federal Water Pollution Control Act, 33 U.S.C. §1251 et seq) DM – New York State Stormwater Management Design Manual (Design Manual), dated July 31, 2024 DOW – Division of Water EAF – Environmental Assessment Form ECL – chapter 43-B of the Consolidated Laws of the State of New York, entitled the Environmental Conservation Law EPA – U.S. Environmental Protection Agency HSG – Hydrologic Soil Group MS4 – Municipal Separate Storm Sewer System NOI – Notice of Intent NOT – Notice of Termination NPDES – National Pollutant Discharge Elimination System NYC – The City of New York NYCDEP – The City of New York Department of Environmental Protection NYSDEC – The New York State Department of Environmental Conservation OPRHP – Office of Parks, Recreation and Historic Places Qf – Extreme Flood Qp – Overbank Flood RR – Runoff Reduction RRv – Runoff Reduction Volume RWE – Regional Water Engineer SEQR – State Environmental Quality Review Act SHPA – State Historic Preservation Act SMP – Post-Construction Stormwater Management Practice SPDES – State Pollutant Discharge Elimination System SWPPP – Stormwater Pollution Prevention Plan TMDL – Total Maximum Daily Load UPA – Uniform Procedures Act USDA – United States Department of Agriculture WQv – Water Quality Volume 55 Appendix A Definitions All definitions in this section are solely for the purposes of this permit. If a word is not italicized in the permit, use its common definition. Agricultural Building – a structure designed and constructed to house farm implements, hay, grain, poultry, livestock or other horticultural products; excluding any structure designed, constructed or used, in whole or in part, for human habitation, as a place of employment where agricultural products are processed, treated or packaged, or as a place used by the public. Agricultural Property – the land for construction of a barn, agricultural building, silo, stockyard, pen or other structural practices identified in Table II in the “Agricultural Best Management Practice Systems Catalogue” (dated June 2023). Alter Hydrology from Pre- to Post-Development Conditions – the post-development peak flow rate(s) has increased by more than 5% of the pre-developed condition for the design storm of interest (e.g. 10 yr and 100 yr). Combined Sewer System – a sewer system which conveys sewage and stormwater through a single pipe system to a publicly owned treatment works. Commence (Commencement of) Construction Activities – the initial disturbance of soils associated with clearing, grading or excavation activities; or other construction related activities that disturb or expose soils such as demolition, stockpiling of fill material, and the initial installation of erosion and sediment control practices required in the SWPPP. See definition for “Construction Activity(ies)” also. Common Plan of Development or Sale – a contiguous area where multiple separate and distinct construction activities are occurring, or may occur, under one plan. The “common plan” of development or sale is broadly defined as any announcement or piece of documentation (including a sign, public notice or hearing, marketing plan, advertisement, drawing, permit application, State Environmental Quality Review Act (SEQR) environmental assessment form or other documents, zoning request, computer design, etc.) or physical demarcation (including boundary signs, lot stakes, surveyor markings, etc.) indicating construction activities may occur on a specific plot. A common plan of development or sale is comprised of two or more phases. Common plan of development or sale does not include separate and distinct construction activities that are occurring, or may occur, under one plan that are at least 1/4 mile apart provided any interconnecting road, pipeline or utility project that is part of the same “common plan” is not concurrently being disturbed. 56 Appendix A Construction Activity(ies) – identified within 40 CFR 122.26(b)(14)(x), 122.26(b)(15)(i), and 122.26(b)(15)(ii), any clearing, grading, excavation, filling, demolition or stockpiling activities that result in soil disturbance. Clearing activities can include, but are not limited to, mechanized logging equipment operation, the cutting and skidding of trees, stump removal and/or brush root removal. Construction activity does not include routine maintenance that is performed to maintain the original line and grade, hydraulic capacity, or original purpose of a facility, which is excluded from the calculation of the soil disturbance for a project. Routine maintenance includes, but is not limited to: ƒRe-grading of gravel roads or parking lots; and ƒCleaning and shaping of existing roadside ditches and culverts that maintains the approximate original line and grade, and maintains or improves the hydraulic capacity of the ditch; and ƒReplacement of existing culverts that maintains the approximate original line and grade, and maintains or improves the hydraulic capacity of a ditch; and ƒReplacement of existing bridges that maintains the approximate original line and grade, and maintains or improves the hydraulic capacity beneath the bridges; and ƒCleaning and shaping of existing roadside ditches that does not maintain the approximate original grade, hydraulic capacity and purpose of the ditch if the changes to the line and grade, hydraulic capacity or purpose of the ditch are installed to improve water quality and quantity controls (e.g. installing grass lined ditch); and ƒPlacement of aggregate shoulder backing that stabilizes the transition between the road shoulder and the ditch or embankment; and ƒFull depth milling and filling of existing asphalt pavements, replacement of concrete pavement slabs, and similar work that does not expose soil or disturb the bottom six (6) inches of subbase material; and ƒLong-term use of equipment storage areas at or near highway maintenance facilities; and ƒRemoval of sediment from the edge of the highway to restore a previously existing sheet-flow drainage connection from the highway surface to the highway ditch or embankment; and ƒExisting use of Canal Corp owned upland disposal sites for the canal, and ƒReplacement of curbs, gutters, sidewalks and guide rail posts; and ƒMaintenance of ski trails including brush hog use and mowing; and ƒAbove ground snowmaking pipe replacement; and ƒReplacement of existing utility poles; etc. Construction Site – the land area where construction activity(ies) will occur. See also the definitions for “Commence (Commencement of) Construction Activities” and “Common Plan of Development or Sale.” 57 Appendix A Dewatering – the act of draining rainwater and/or groundwater from building foundations, vaults or excavations/trenches. Directly Discharge(s)(ing) (to a specific surface waterbody) – runoff flows from a construction site by overland flow and the first point of discharge is the specific surface waterbody, or runoff flows from a construction site to a separate storm sewer system and the first point of discharge from the separate storm sewer system is the specific surface waterbody. Discharge(s)(d) – any addition of any pollutant to waters of the State through an outlet or point source. Embankment – an earthen or rock slope that supports a road/highway. Equivalent (Equivalence) – the practice or measure meets all the performance, longevity, maintenance, and safety objectives of the technical standard and will provide an equal or greater degree of water quality protection. Final Stabilization – all soil disturbance activities have ceased and a uniform, perennial vegetative cover with a density of eighty (80) percent over the entire pervious surface has been established; or other equivalent stabilization measures, such as permanent landscape mulches, rock rip-rap or washed/crushed stone have been applied on all disturbed areas that are not covered by permanent structures, concrete or pavement. Historic Property – any building, structure, site, object or district that is listed on the State or National Registers of Historic Places or is determined to be eligible for listing on the State or National Registers of Historic Places. Impervious Area (Cover) – all impermeable surfaces that cannot effectively infiltrate rainfall. This includes paved, concrete and compacted gravel surfaces (i.e. parking lots, driveways, roads, runways and sidewalks); building rooftops and miscellaneous impermeable structures such as patios, pools, and sheds. Infeasible – not technologically possible, or not economically practicable and achievable considering best industry practices. Minimize(ing)(ation) – reduce and/or eliminate to the extent achievable using control measures (including best management practices) that are technologically available and economically practicable and achievable in light of best industry practices. Municipal Separate Storm Sewer System (MS4) - a conveyance or system of conveyances (including roads with drainage systems, municipal streets, catch basins, curbs, gutters, ditches, man-made channels, or storm drains): 58 Appendix A 1. owned or operated by a State, city, town, village, borough, county, parish, district, association, or other public body (created by or pursuant to State law) having jurisdiction over disposal of sewage, industrial wastes, stormwater, or other wastes, including special districts under State law such as a sewer district, flood control district or drainage district, or similar entity, or an Indian tribe or an authorized Indian tribal organization, or a designated and approved management agency under section 208 of the CWA, that discharges to surface waters of the State; and 2. designed or used for collecting or conveying stormwater; and 3. which is not a combined sewer system; and 4. which is not part of a Publicly Owned Treatment Works (POTW) as defined at 40 CFR 122.2. Natural Buffer(s) – an undisturbed area with natural cover running along a surface water (e.g. wetland, stream, river, lake, etc.). New Development – any land disturbance that does not meet the definition of Redevelopment Activity included in this appendix. New York State Erosion and Sediment Control Certificate Program – a certificate program that establishes and maintains a process to identify and recognize individuals who are capable of developing, designing, inspecting and maintaining erosion and sediment control plans on projects that disturb soils in New York State. The certificate program is administered by the New York State Conservation District Employees Association. Nonpoint Source(s) – any source of water pollution or pollutants which is not a discrete conveyance or point source permitted pursuant to Title 7 or 8 of Article 17 of the Environmental Conservation Law (see ECL Section 17-1403). Overbank – flow events that exceed the capacity of the stream channel and spill out into the adjacent floodplain. Owner or Operator – the person, persons, or legal entity which owns or leases the property on which the construction activity is occurring; an entity that has operational control over the construction plans and specifications, including the ability to make modifications to the plans and specifications; and/or an entity that has day-to-day operational control of those activities at a project that are necessary to ensure compliance with the permit requirements. 59 Appendix A Performance Criteria – the six performance criteria for each group of SMPs in Chapters 5 and 6 of the technical standard, New York State Stormwater Management Design Manual (DM), dated July 31, 2024. These include feasibility, conveyance, pretreatment, treatment, landscaping, and maintenance. It does not include the Sizing Criteria (i.e. WQv, RRv, CPv, Qp and Qf) in Part I.C.2. of the permit. Phase – a defined area in which construction activities are occurring or will occur separate from other defined area(s). Point Source – any discernible, confined, and discrete conveyance, including but not limited to any pipe, ditch, channel, tunnel, conduit, well, discrete fissure, container, rolling stock, concentrated animal feeding operation, vessel or other floating craft, or landfill leachate collection system from which pollutants are or may be discharged. Pollutant(s) – dredged spoil, filter backwash, solid waste, incinerator residue, sewage, garbage, sewage sludge, munitions, chemical wastes, biological materials, radioactive materials, heat, wrecked or discarded equipment, rock, sand and industrial, municipal, agricultural waste and ballast discharged into water; which may cause or might reasonably be expected to cause pollution of the waters of the state in contravention of the standards or guidance values adopted as provided in 6 NYCRR Parts 700 et seq. Qualified Inspector – a person that is knowledgeable in the principles and practices of erosion and sediment control, such as a licensed Professional Engineer, Certified Professional in Erosion and Sediment Control (CPESC), Registered Landscape Architect, New York State Erosion and Sediment Control Certificate Program holder or other NYSDEC endorsed individual(s). It can also mean someone working under the direct supervision of, and at the same company as, the licensed Professional Engineer or Registered Landscape Architect, provided that person has training in the principles and practices of erosion and sediment control. Training in the principles and practices of erosion and sediment control means that the individual working under the direct supervision of the licensed Professional Engineer or Registered Landscape Architect has received four (4) hours of NYSDEC endorsed training in proper erosion and sediment control principles from a Soil and Water Conservation District, or other NYSDEC endorsed entity. After receiving the initial training, the individual working under the direct supervision of the licensed Professional Engineer or Registered Landscape Architect shall receive four (4) hours of training every three (3) years. It can also mean a person that meets the Qualified Professional qualifications in addition to the Qualified Inspector qualifications. Note: Inspections of any SMPs that include structural components, such as a dam for an impoundment, shall be performed by a licensed Professional Engineer. 60 Appendix A Qualified Professional – a person that is knowledgeable in the principles and practices of stormwater management and treatment, such as a licensed Professional Engineer, Registered Landscape Architect or other NYSDEC endorsed individual(s). Individuals preparing SWPPPs that require the SMP component must have an understanding of the principles of hydrology, water quality management practice design, water quantity control design, and, in many cases, the principles of hydraulics. All components of the SWPPP that involve the practice of engineering, as defined by the NYS Education Law (see Article 145), shall be prepared by, or under the direct supervision of, a professional engineer licensed to practice in the State of New York. Redevelopment Activity(ies) – the disturbance and reconstruction of existing impervious area, including impervious areas that were removed from a project site within five (5) years of preliminary project plan submission to the local government (i.e. site plan, subdivision, etc.). Renewable Energy – electricity or thermal energy generated by renewable energy systems through use of the following technologies: solar thermal, photovoltaics, on land and offshore wind, hydroelectric, geothermal electric, geothermal ground source heat, tidal energy, wave energy, ocean thermal, and fuel cells which do not utilize a fossil fuel resource in the process of generating electricity. Site Limitations – site conditions that prevent the use of an infiltration technique and or infiltration of the total WQv. Typical site limitations include: seasonal high groundwater, shallow depth to bedrock, and soils with an infiltration rate less than 0.5 inches/hour. The existence of site limitations shall be confirmed and documented using actual field testing (i.e. test pits, soil borings, and infiltration test) or using information from the most current United States Department of Agriculture (USDA) Soil Survey for the County where the project is located. Sizing Criteria – the criteria included in Part I.C.2 of the permit that are used to size SMPs. The criteria include; Water Quality Volume (WQv), Runoff Reduction Volume (RRv), Channel Protection Volume (Cpv), Overbank Flood (Qp), and Extreme Flood (Qf). Steep Slope – land area designated on the current United States Department of Agriculture (USDA) Soil Survey as Soil Slope Phase D, (provided the map unit name or description is inclusive of slopes greater than 25%), or Soil Slope Phase E or F, (regardless of the map unit name), or a combination of the three designations. Stormwater – that portion of precipitation that, once having fallen to the ground, is in excess of the evaporative or infiltrative capacity of soils, or the retentive capacity of surface features, which flows or will flow off the land by surface runoff to waters of the State. 61 Appendix A Streambank – the terrain alongside the bed of a creek or stream. The bank consists of the sides of the channel, between which the flow is confined. Stormwater Pollution Prevention Plan (SWPPP) – a project specific report, including construction drawings, that among other things: describes the construction activity(ies), identifies the potential sources of pollution at the construction site; describes and shows the stormwater controls that will be used to control the pollutants (i.e. erosion and sediment controls; for many projects, includes SMPs); and identifies procedures the owner or operator will implement to comply with the requirements of the permit. See Part III of the permit for a complete description of the information that must be included in the SWPPP. Surface Waters of the State – shall be construed to include lakes, bays, sounds, ponds, impounding reservoirs, springs, rivers, streams, creeks, estuaries, marshes, inlets, canals, the Atlantic ocean within the territorial seas of the state of New York and all other bodies of surface water, natural or artificial, inland or coastal, fresh or salt, public or private (except those private waters that do not combine or effect a junction with natural surface waters), which are wholly or partially within or bordering the state or within its jurisdiction. Waters of the state are further defined in 6 NYCRR Parts 800 to 941. Temporarily Ceased – an existing disturbed area will not be disturbed again within 14 calendar days of the previous soil disturbance. Temporary Stabilization – exposed soil has been covered with material(s) as set forth in the technical standard, New York Standards and Specifications for Erosion and Sediment Control, to prevent the exposed soil from eroding. The materials can include, but are not limited to, mulch, seed and mulch, and erosion control mats (e.g. jute twisted yarn, excelsior wood fiber mats). Total Maximum Daily Load (TMDL) – the sum of the allowable loads of a single pollutant from all contributing point and nonpoint sources. It is a calculation of the maximum amount of a pollutant that a waterbody can receive and still meet water quality standards, and an allocation of that amount to the pollutant's sources. A TMDL stipulates Waste Load Allocations (WLA) for point source discharges, Load Allocations (LA) for nonpoint sources, and a margin of safety (MOS). Traditional Land Use Control MS4 Operator – a city, town, or village with land use control authority that is authorized to discharge under New York State DEC’s SPDES General Permit For Stormwater Discharges from Municipal Separate Stormwater Sewer Systems (MS4s) or the City of New York’s Individual SPDES Permit for their Municipal Separate Storm Sewer Systems (NY-0287890). Trained Contractor – an employee from the contracting (construction) company, identified in Part III.A.7., that has received four (4) hours of NYSDEC endorsed training 62 Appendix A in proper erosion and sediment control principles from a Soil and Water Conservation District, or other NYSDEC endorsed entity. After receiving the initial training, the trained contractor shall receive four (4) hours of training every three (3) years. It can also mean an employee from the contracting (construction) company, identified in Part III.A.7., that meets the qualified inspector qualifications (e.g. licensed Professional Engineer, Certified Professional in Erosion and Sediment Control (CPESC), Registered Landscape Architect, New York State Erosion and Sediment Control Certificate Program holder, or someone working under the direct supervision of, and at the same company as, the licensed Professional Engineer or Registered Landscape Architect, provided they have received four (4) hours of NYSDEC endorsed training in proper erosion and sediment control principles from a Soil and Water Conservation District, or other NYSDEC endorsed entity). The trained contractor is responsible for the day-to-day implementation of the SWPPP. Tree Clearing – construction activities limited to felling and removal of trees. Tree clearing does not include hand felling and leaving the trees in place with no support from mechanized equipment, which is not considered construction activity requiring coverage under this permit. Water Quality Standard – such measures of purity or quality for any waters in relation to their reasonable and necessary use as promulgated in 6 NYCRR Part 700 et seq. 63 Appendix B APPENDIX B – Required SWPPP Components by Project Type Table 1 CONSTRUCTION ACTIVITIES THAT REQUIRE THE PREPARATION OF A SWPPP THAT ONLY INCLUDES EROSION AND SEDIMENT CONTROLS The following construction activities that involve soil disturbances of one (1) or more acres of land, but less than five (5) acres: • Single-family home not located in one of the watersheds listed in Appendix C and not directly discharging to one of the 303(d) segments listed in Appendix D • Single-family residential subdivisions with 25% or less impervious cover at total site build-out and not located in one of the watersheds listed in Appendix C and not directly discharging to one of the 303(d) segments listed in Appendix D • Construction of a barn or other agricultural building, silo, stock yard or pen. • Structural agricultural conservation practices as identified in Table II in the “Agricultural Best Management Practice Systems Catalogue” (dated June 2023) that include construction or reconstruction of impervious area or alter hydrology from pre- to post-development conditions. The following construction activities that involve soil disturbances between five thousand (5000) square feet and one (1) acre of land: • All construction activities located in the New York City Watershed located east of the Hudson River, see Appendix C Figure 1, that involve soil disturbances between five thousand (5,000) square feet and one (1) acre of land. Within the municipal boundaries of NYC: • Stand-alone road reconstruction, where the total soil disturbance from only that road construction, is less than one (1) acre of land. The following construction activities: • Installation of underground linear utilities; such as gas lines, fiber-optic cable, cable TV, electric, telephone, sewer mains, and water mains • Environmental enhancement projects, such as wetland mitigation, stormwater retrofits, stream restoration, and resiliency projects that reconstruct shoreline areas to address sea level rise • Pond construction • Linear bike paths running through areas with vegetative cover, including bike paths surfaced with an impervious cover • Cross-country ski trails, walking/hiking trails, and mountain biking trails, including a de minimis parking lot (maximum 10 spaces total, sized for passenger cars) with 35 feet minimum preservation of undisturbed area downgradient from the parking lot • Dam rehabilitation (the structure of the dam itself) • Sidewalks, bike paths, or walking paths, surfaced with an impervious cover, that are not part of residential, commercial, or institutional development; • Sidewalks, bike paths, or walking paths, surfaced with an impervious cover, that include incidental shoulder or curb work along an existing highway to support construction of the sidewalk, bike path, or walking path. 64 Appendix B Table 1 (Continued) CONSTRUCTION ACTIVITIES THAT REQUIRE THE PREPARATION OF A SWPPP THAT ONLY INCLUDES EROSION AND SEDIMENT CONTROLS The following construction activities: • Slope stabilization • Slope flattening that changes the grade of the site, but does not significantly change the runoff characteristics • Spoil areas that will be covered with vegetation • Vegetated open space (i.e. recreational parks, lawns, meadows, fields, downhill ski trails) that do not alter hydrology from pre- to post-development conditions • Athletic fields (natural grass) that do not include the construction or reconstruction of impervious area and do not alter hydrology from pre- to post-development conditions • Demolition where vegetation will be established, and no redevelopment activity is planned1 • Installation or replacement of either an overhead electric transmission line or a ski lift tower that does not include the construction of permanent access roads or parking areas surfaced with impervious cover. • Solar array field areas that have tables elevated off the ground, spaced one table width apart, do not alter hydrology from pre- to post-development conditions, and address water quality volume and runoff reduction volume by maintaining sheet flow on slopes less than 8%. • Structural agricultural conservation practices as identified in Table II in the “Agricultural Best Management Practice Systems Catalogue” (dated June 2023) that do not include construction or reconstruction of impervious area and do not alter hydrology from pre- to post-development conditions. • Temporary access roads, median crossovers, detour roads, lanes, or other temporary impervious areas that will be restored to pre-construction conditions once the construction activity is complete (in this context, “temporary” means the impervious area will be in place for two years or less) • Other construction activities that do not include the construction or reconstruction of impervious area, and do not alter hydrology from pre- to post-development conditions, and are not listed in Table 2. 1. If the site is redeveloped in the future, a new eNOI must be submitted. 65 Appendix B Table 2 CONSTRUCTION ACTIVITIES THAT REQUIRE THE PREPARATION OF A SWPPP THAT INCLUDES POST-CONSTRUCTION STORMWATER MANAGEMENT PRACTICES (SMPS) The following construction activities: • Single-family home located in one of the watersheds listed in Appendix C or directly discharging to one of the 303(d) segments listed in Appendix D • Single-family home that disturbs five (5) or more acres of land • Single-family residential subdivisions located in one of the watersheds listed in Appendix C or directly discharging to one of the 303(d) segments listed in Appendix D • Single-family residential subdivisions that involve soil disturbances of between one (1) and five (5) acres of land with greater than 25% impervious cover at total site build-out • Single-family residential subdivisions that involve soil disturbances of between 20,000 square feet and one (1) acre of land within the municipal boundaries of NYC with greater than 25% impervious cover at total site build-out • Single-family residential subdivisions that involve soil disturbances of five (5) or more acres of land, and single-family residential subdivisions that involve soil disturbances of less than five (5) acres that are part of a common plan of development or sale that will ultimately disturb five (5) or more acres of land • Multi-family residential developments; includes duplexes, townhomes, condominiums, senior housing complexes, apartment complexes, and mobile home parks • Creation of 5,000 square feet or more of impervious area in the municipal boundaries of NYC • Airports • Amusement parks • Breweries, cideries, and wineries, including establishments constructed on agricultural land • Campgrounds • Cemeteries that include the construction or reconstruction of impervious area (>5% of disturbed area) or alter the hydrology from pre- to post-development conditions • Commercial developments • Churches and other places of worship • Construction of a barn or other agricultural building (e.g. silo) that involves soil disturbance greater than five acres. • Structural agricultural conservation practices as identified in Table II in the “Agricultural Best Management Practice Systems Catalogue” (dated June 2023) that involves soil disturbance greater than five acres and include the construction or reconstruction of impervious area or alter hydrology from pre- to post-development conditions. • Facility buildings, including ski lodges, restroom buildings, pumphouses, ski lift terminals, and maintenance and groomer garages • Institutional development; includes hospitals, prisons, schools and colleges • Industrial facilities; includes industrial parks • Landfills; including creation of landfills or capping landfills. • Municipal facilities; includes highway garages, transfer stations, office buildings, POTWs, water treatment plants, and water storage tanks • Golf courses • Office complexes 66 Appendix B Table 2 (Continued) CONSTRUCTION ACTIVITIES THAT REQUIRE THE PREPARATION OF A SWPPP THAT INCLUDES POST-CONSTRUCTION STORMWATER MANAGEMENT PRACTICES (SMPS) The following construction activities: • Permanent laydown yards and equipment storage lots • Playgrounds that include the construction or reconstruction of impervious area • Sports complexes • Racetracks; includes racetracks with earthen (dirt) surfaces • Road construction or reconstruction, outside the municipal boundaries of NYC • Road construction within the municipal boundaries of NYC • Stand-alone road reconstruction, within the municipal boundaries of NYC where the total soil disturbance from that road reconstruction involves soil disturbance of one (1) acre or more of land • Parking lot construction or reconstruction (as with all Table 2 bullets, this includes parking lots constructed as part of the construction activities listed in Table 1, unless a Table 1 bullet specifies otherwise) • Athletic fields (natural grass) that include the construction or reconstruction of impervious area (>5% of disturbed area) or alter the hydrology from pre- to post-development conditions • Athletic fields with artificial turf • Permanent access roads, parking areas, substations, compressor stations, and well drilling pads, surfaced with impervious cover, and constructed as part of an overhead electric transmission line, wind-power, cell tower, oil or gas well drilling, sewer or water main, ski lift, or other linear utility project • Sidewalks, bike paths, or walking paths, surfaced with an impervious cover, that are part of a residential, commercial or institutional development • Sidewalks, bike paths, or walking paths, surfaced with an impervious cover, that are part of highway construction or reconstruction • Solar array field areas on slopes greater than 8% that cannot maintain sheet flow using management practices identified in the BB or the DM • Solar array field areas on slopes less than 8% that will alter the hydrology from pre- to post- development conditions • Solar array field areas with tables that are not elevated high enough to achieve final stabilization beneath the tables • Traditional impervious areas associated with solar development (e.g. roads, buildings, transformers) • Utility pads surfaced with impervious cover, including electric vehicle charging stations • All other construction activities that include the construction or reconstruction of impervious area or alter the hydrology from pre- to post-development conditions, and are not listed in Table 1 67 Appendix C APPENDIX C – Watersheds Requiring Enhanced Phosphorus Removal Watersheds where owners or operators of construction activities identified in Table 2 of Appendix B must prepare a SWPPP that includes SMPs designed in conformance with the Enhanced Phosphorus Removal Standards included in the DM technical standard. • Entire New York City Watershed located east of the Hudson River – Figure 1 • Onondaga Lake Watershed – Figure 2 • Greenwood Lake Watershed – Figure 3 • Oscawana Lake Watershed – Figure 4 • Kinderhook Lake Watershed – Figure 5 68 Appendix C Figure 1 - New York City Watershed East of the Hudson 69 Appendix C Figure 2 - Onondaga Lake Watershed 70 Appendix C Figure 3 - Greenwood Lake Watershed 71 Appendix C Figure 4 - Oscawana Lake Watershed 72 Appendix C Figure 5 - Kinderhook Lake Watershed 73 APPENDIX D – Impaired Waterbodies (by Construction Related Pollutants) List of waterbodies impaired by pollutants related to construction activity, including turbidity, silt/sediment, and nutrients (e.g. nitrogen, phosphorus). This list is a subset of “The Final New York State 2018 Section 303(d) List of Impaired Waters Requiring a TMDL” dated June 2020. County Waterbody Pollutant Albany Ann Lee (Shakers) Pond, Stump Pond (1201-0096) Phosphorus Albany Lawsons Lake (1301-0235) Phosphorus Allegany Amity Lake, Saunders Pond (0403-0054) Phosphorus Allegany Andover Pond (0403-0056) Phosphorus Bronx Reservoir No.1/Lake Isle (1702-0075) Phosphorus Bronx Van Cortlandt Lake (1702-0008) Phosphorus Broome Blueberry, Laurel Lakes (1404-0033) Phosphorus Broome Fly Pond, Deer Lake (1404-0038) Phosphorus Broome Minor Tribs to Lower Susquehanna (0603-0044) Phosphorus Broome Whitney Point Lake/Reservoir (0602-0004) Phosphorus Cattaraugus Allegheny River/Reservoir (0201-0023) Phosphorus Cattaraugus Beaver Lake/Alma Pond (0201-0073) Phosphorus Cattaraugus Case Lake (0201-0020) Phosphorus Cattaraugus Linlyco/Club Pond (0201-0035) Phosphorus Cayuga Duck Lake (0704-0025) Phosphorus Cayuga Owasco Inlet, Upper, and tribs (0706-0014) Nutrients Chautauqua Chadakoin River and tribs (0202-0018) Phosphorus Chautauqua Hulburt/Clymer Pond (0202-0079) Phosphorus Chautauqua Middle Cassadaga Lake (0202-0002) Phosphorus Clinton Great Chazy River, Lower, Main Stem (1002-0001) Silt/Sediment Columbia Robinson Pond (1308-0003) Phosphorus Cortland Dean Pond (0602-0077) Phosphorus Dutchess Fallkill Creek (1301-0087) Phosphorus Dutchess Hillside Lake (1304-0001) Phosphorus Dutchess Wappingers Lake (1305-0001) Phosphorus Dutchess Wappingers Lake (1305-0001) Silt/Sediment Erie Beeman Creek and tribs (0102-0030) Phosphorus Erie Delaware Park Pond (0101-0026) Phosphorus Erie Ellicott Creek, Lower, and tribs (0102-0018) Phosphorus Erie Ellicott Creek, Lower, and tribs (0102-0018) Silt/Sediment Erie Green Lake (0101-0038) Phosphorus Erie Little Sister Creek, Lower, and tribs (0104-0045) Phosphorus Erie Murder Creek, Lower, and tribs (0102-0031) Phosphorus Erie Rush Creek and tribs (0104-0018) Phosphorus Erie Scajaquada Creek, Lower, and tribs (0101-0023) Phosphorus Erie Scajaquada Creek, Middle, and tribs (0101-0033) Phosphorus Erie Scajaquada Creek, Upper, and tribs (0101-0034) Phosphorus Erie South Branch Smoke Cr, Lower, and tribs (0101-0036) Phosphorus Erie South Branch Smoke Cr, Lower, and tribs (0101-0036) Silt/Sediment Genesee Bigelow Creek and tribs (0402-0016) Phosphorus Genesee Black Creek, Middle, and minor tribs (0402 0028) Phosphorus Genesee Black Creek, Upper, and minor tribs (0402-0048) Phosphorus Genesee Bowen Brook and tribs (0102-0036) Phosphorus Genesee LeRoy Reservoir (0402-0003) Phosphorus Genesee Mill Pond (0402-0050) Phosphorus Genesee Oak Orchard Cr, Upper, and tribs (0301-0014) Phosphorus Genesee Oatka Creek, Middle, and minor tribs (0402-0031) Phosphorus Genessee Tonawanda Cr, Middle, Main Stem (0102-0002) Phosphorus Greene Schoharie Reservoir (1202-0012) Silt/Sediment Greene Sleepy Hollow Lake (1301-0059) Silt/Sediment Herkimer Steele Creek tribs (1201-0197) Phosphorus Herkimer Steele Creek tribs (1201-0197) Silt/Sediment Kings Hendrix Creek (1701-0006) 18 Nitrogen Kings Prospect Park Lake (1701-0196) Phosphorus Lewis Mill Creek/South Branch, and tribs (0801-0200) Nutrients Livingston Christie Creek and tribs (0402-0060) Phosphorus Livingston Conesus Lake (0402-0004) Phosphorus Livingston Mill Creek and minor tribs (0404-0011) Silt/Sediment Monroe Black Creek, Lower, and minor tribs (0402-0033) Phosphorus Monroe Buck Pond (0301-0017) Phosphorus Monroe Cranberry Pond (0301-0016) Phosphorus Monroe Durand, Eastman Lakes (0302-0037) Phosphorus Monroe Lake Ontario Shoreline, Western (0301-0069) 9 Phosphorus Monroe Long Pond (0301-0015) Phosphorus Monroe Mill Creek and tribs (0302-0025) Phosphorus 2 Monroe Mill Creek/Blue Pond Outlet and tribs (0402-0049) Phosphorus Monroe Minor Tribs to Irondequoit Bay (0302-0038) Phosphorus Monroe Rochester Embayment - East (0302-0002) [9] Phosphorus Monroe Rochester Embayment - West (0301-0068) 9 Phosphorus Monroe Shipbuilders Creek and tribs (0302-0026) Phosphorus 2 Monroe Thomas Creek/White Brook and tribs (0302-0023) Phosphorus 75 Nassau Bannister Creek/Bay (1701-0380) Nitrogen Nassau Beaver Lake (1702-0152) Phosphorus Nassau Browswere Bay (1701-0383) Nitrogen Nassau Camaans Pond (1701-0052) Phosphorus Nassau East Meadow Brook, Upper, and tribs (1701-0211) Silt/Sediment Nassau East Rockaway Channel (1701-0381) Nitrogen Nassau Glen Cove Creek, Lower, and tribs (1702-0146) Silt/Sediment Nassau Grant Park Pond (1701-0054) Phosphorus Nassau Hempstead Bay, Broad Channel (1701-0032) Nitrogen Nassau Hempstead Lake (1701-0015) Phosphorus Nassau Hewlett Bay (1701-0382) Nitrogen Nassau Hog Island Channel (1701-0220) Nitrogen Nassau Massapequa Creek, Upper, and tribs (1701-0174) Phosphorus Nassau Milburn/Parsonage Creeks, Upp, and tribs (1701- 0212) Phosphorus Nassau Reynolds Channel, East (1701-0215) [12] Nitrogen Nassau Reynolds Channel, West (1701-0216) 12 Nitrogen Nassau Tidal Tribs to Hempstead Bay (1701-0218) Nitrogen Nassau Tribs (fresh) to East Bay (1701-0204) Silt/Sediment Nassau Tribs (fresh) to East Bay (1701-0204) Phosphorus Nassau Tribs to Smith Pond/Halls Pond (1701-0221) Phosphorus Nassau Woodmere Channel (1701-0219) Nitrogen New York Harlem Meer (1702-0103) Phosphorus New York The Lake in Central Park (1702-0105) Phosphorus Niagara Bergholtz Creek and tribs (0101-0004) Phosphorus Niagara Hyde Park Lake (0101-0030) Phosphorus Niagara Lake Ontario Shoreline, Western (0301-0053) 9 Phosphorus Niagara Lake Ontario Shoreline, Western (0301-0072) 9 Phosphorus Oneida Ballou, Nail Creeks (1201-0203) Phosphorus Onondaga Ley Creek and tribs (0702-0001) 10 Nutrients (phosphorus) Onondaga Minor Tribs to Onondaga Lake (0702-0022) 10 Nutrients (phosphorus) Onondaga Minor Tribs to Onondaga Lake (0702-0022) 10 Nitrogen (NH3, NO2) Onondaga Onondaga Creek, Lower (0702-0023) 10 Nutrients (phosphorus) Onondaga Onondaga Creek, Lower, and tribs (0702-0023) Turbidity Onondaga Onondaga Creek, Middle, and tribs (0702-0004) Turbidity Onondaga Onondaga Creek, Upper, and tribs (0702-0024) Turbidity Ontario Great Brook and minor tribs (0704-0034) Phosphorus 2 Ontario Great Brook and minor tribs (0704-0034) Silt/Sediment 76 Ontario Hemlock Lake Outlet and minor tribs (0402-0013) Phosphorus Ontario Honeoye Lake (0402-0032) Phosphorus Orange Brown Pond Reservoir (1303-0013) Phosphorus Orange Lake Washington (1303-0012) Phosphorus Orange Minor Tribs to Middle Wallkill (1306-0061) Phosphorus Orange Monhagen Brook and tribs (1306-0074) Phosphorus Orange Orange Lake (1301-0008) [16] Phosphorus Orange Quaker Creek and tribs (1306-0025) Phosphorus Orange Wallkill River, Middle, Main Stem (1306-0038) Phosphorus Orange Wallkill River, Upper, and Minor tribs (1306-0017) Phosphorus Orleans Glenvwood Lake (0301-0041) Phosphorus Orleans Lake Ontario Shoreline, Western (0301-0070) 9 Phosphorus Orleans Lake Ontario Shoreline, Western (0301-0071) 9 Phosphorus Oswego Lake Neatahwanta (0701-0018) Nutrients (phosphorus) Oswego Pleasant Lake (0703-0047) Phosphorus Putnam Lost Lake, Putnam Lake (1302-0053) Phosphorus Putnam Minor Tribs to Croton Falls Reservoir (1302-0001) Phosphorus Queens Bergen Basin (1701-0009) 18 Nitrogen Queens Jamaica Bay, Eastern, and tribs, Queens (1701- 0005) 18 Nitrogen Queens Kissena Lake (1702-0258) Phosphorus Queens Meadow Lake (1702-0030) Phosphorus Queens Shellbank Basin (1701-0001) 18 Nitrogen Queens Willow Lake (1702-0031) Phosphorus Rensselaer Nassau Lake (1310-0001) Phosphorus Rensselaer Snyders Lake (1301-0043) Phosphorus Richmond Grassmere Lake/Bradys Pond (1701-0357) Phosphorus Rockland Congers Lake, Swartout Lake (1501-0019) Phosphorus Rockland Rockland Lake (1501-0021) Phosphorus Saratoga Ballston Lake (1101-0036) Phosphorus Saratoga Dwaas Kill and tribs (1101-0007) Phosphorus Saratoga Dwaas Kill and tribs (1101-0007) Silt/Sediment Saratoga Lake Lonely (1101-0034) Phosphorus Saratoga Round Lake (1101-0060) Phosphorus Saratoga Tribs to Lake Lonely (1101-0001) Phosphorus Schenectady Collins Lake (1201-0077) Phosphorus Schenectady Duane Lake (1311-0006) Phosphorus Schenectady Lake Mariaville Lake (1201-0113) Phosphorus Schuyler Cayuta Lake (0603-0005) Phosphorus 77 Seneca Reeder Creek and tribs (0705-0074) Phosphorus St.Lawrence Black Lake Outlet, Black Lake (0906-0001) Phosphorus St.Lawrence Fish Creek and minor tribs (0906-0026) Phosphorus Steuben Smith Pond (0502-0012) Phosphorus Suffolk Agawam Lake (1701-0117) Phosphorus Suffolk Big/Little Fresh Ponds (1701-0125) Phosphorus Suffolk Canaan Lake (1701-0018) Phosphorus Suffolk Canaan Lake (1701-0018) Silt/Sediment Suffolk Fresh Pond (1701-0241) Phosphorus Suffolk Great South Bay, East (1701-0039) Nitrogen Suffolk Great South Bay, Middle (1701-0040) Nitrogen Suffolk Great South Bay, West (1701-0173) Nitrogen Suffolk Lake Ronkonkoma (1701-0020) Phosphorus Suffolk Mattituck/Marratooka Pond (1701-0129) Phosphorus Suffolk Mill and Seven Ponds (1701-0113) Phosphorus Suffolk Millers Pond (1702-0013) Phosphorus Suffolk Moriches Bay, East (1701-0305) Nitrogen Suffolk Moriches Bay, West (1701-0038) Nitrogen Suffolk Quantuck Bay (1701-0042) Nitrogen Suffolk Shinnecock Bay and Inlet (1701-0033) Nitrogen Suffolk Tidal Tribs to West Moriches Bay (1701-0312) Nitrogen Sullivan Bodine, Mongomery Lakes (1401-0091) Phosphorus Sullivan Davies Lake (1402-0047) Phosphorus Sullivan Evens Lake (1402-0004) Phosphorus Sullivan Pleasure Lake (1402-0055) Phosphorus Sullivan Swan Lake (1401-0063) Phosphorus Tompkins Cayuga Lake, Southern End (0705-0040) Phosphorus Tompkins Cayuga Lake, Southern End (0705-0040) Silt/Sediment Ulster Ashokan Reservoir (1307-0004) Silt/Sediment Ulster Esopus Creek, Lower, Main Stem (1307-0010) [17] Turbidity Ulster Esopus Creek, Middle, Main Stem (1307-0003) 17 Turbidity Ulster Esopus Creek, Upper, and minor tribs (1307-0007)[3] Silt/Sediment Ulster Wallkill River, Lower, Main Stem (1306-0027) Phosphorus Warren Hague Brook and tribs (1006-0006) Silt/Sediment Warren Huddle/Finkle Brooks and tribs (1006-0003) Silt/Sediment Warren Indian Brook and tribs (1006-0002) Silt/Sediment Warren Lake George (1006-0016) and tribs Silt/Sediment Warren Tribs to Lake George, East Shore (1006-0020) Silt/Sediment Warren Tribs to Lake George, Lk.George Village (1006-0008) Silt/Sediment 78 Washington Wood Cr/Champlain Canal and tribs (1005-0036) Phosphorus Westchester Lake Katonah (1302-0136) Phosphorus Westchester Lake Lincolndale (1302-0089) Phosphorus Westchester Lake Meahagh (1301-0053) Phosphorus Westchester Lake Mohegan (1301-0149) Phosphorus Westchester Lake Shenorock (1302-0083) Phosphorus Westchester Mamaroneck River, Lower (1702-0071) Silt/Sediment Westchester Mamaroneck River, Upp, & minor tribs (1702-0123) Silt/Sediment Westchester Saw Mill River (1301-0007) Phosphorus Westchester Saw Mill River, Middle, and tribs (1301-0100) Phosphorus Westchester Sheldrake River (1702-0069) Phosphorus Westchester Sheldrake River (1702-0069) Silt/Sedimnt Westchester Silver Lake (1702-0040) Phosphorus Westchester Teatown Lake (1302-0150) Phosphorus Westchester Truesdale Lake (1302-0054) Phosphorus Westchester Wallace Pond (1301-0140) Phosphorus 79 APPENDIX E – List of NYSDEC Regional Offices Region COVERING THE FOLLOWING COUNTIES: DIVISION OF ENVIRONMENTAL PERMITS (DEP) PERMIT ADMINISTRATORS DIVISION OF WATER (DOW) WATER (SPDES) PROGRAM 1 NASSAU AND SUFFOLK 50 CIRCLE ROAD STONY BROOK, NY 11790 TEL. (631) 444-0365 50 CIRCLE ROAD STONY BROOK, NY 11790-3409 TEL. (631) 444-0405 2 BRONX, KINGS, NEW YORK, QUEENS AND RICHMOND 1 HUNTERS POINT PLAZA, 47-40 21ST ST. LONG ISLAND CITY, NY 11101-5407 TEL. (718) 482-4997 1 HUNTERS POINT PLAZA, 47-40 21ST ST. LONG ISLAND CITY, NY 11101-5407 TEL. (718) 482-4933 3 DUTCHESS, ORANGE, PUTNAM, ROCKLAND, SULLIVAN, ULSTER AND WESTCHESTER 21 SOUTH PUTT CORNERS ROAD NEW PALTZ, NY 12561-1696 TEL. (845) 256-3059 220 WHITE PLAINS ROAD, SUITE 110 TEL. (914) 428 - 2505 4 ALBANY, COLUMBIA, DELAWARE, GREENE, MONTGOMERY, OTSEGO, RENSSELAER, SCHENECTADY AND SCHOHARIE 1130 NORTH WESTCOTT ROAD SCHENECTADY, NY 12306-2014 TEL. (518) 357-2069 1130 NORTH WESTCOTT ROAD SCHENECTADY, NY 12306-2014 TEL. (518) 357-2045 5 CLINTON, ESSEX, FRANKLIN, FULTON, HAMILTON, SARATOGA, WARREN AND WASHINGTON 1115 STATE ROUTE 86, PO BOX 296 RAY BROOK, NY 12977-0296 TEL. (518) 897-1234 232 GOLF COURSE ROAD WARRENSBURG, NY 12885-1172 TEL. (518) 623-1200 6 HERKIMER, JEFFERSON, LEWIS, ONEIDA AND ST. LAWRENCE STATE OFFICE BUILDING 317 WASHINGTON STREET WATERTOWN, NY 13601-3787 TEL. (315) 785-2245 STATE OFFICE BUILDING 207 GENESEE STREET UTICA, NY 13501-2885 TEL. (315) 793-2554 7 BROOME, CAYUGA, CHENANGO, CORTLAND, MADISON, ONONDAGA, OSWEGO, TIOGA AND TOMPKINS 5786 WIDEWATERS PARKWAY SYRACUSE, NY 13214-1867 TEL. (315) 426-7438 5786 WIDEWATERS PARKWAY SYRACUSE, NY 13214-1867 TEL. (315) 426-7500 8 CHEMUNG, GENESEE, LIVINGSTON, MONROE, ONTARIO, ORLEANS, SCHUYLER, SENECA, STEUBEN, WAYNE AND YATES 6274 EAST AVON-LIMA ROADAVON, NY 14414-9519 TEL. (585) 226-2466 6274 EAST AVON-LIMA RD. AVON, NY 14414-9519 TEL. (585) 226-2466 9 ALLEGANY, CATTARAUGUS, CHAUTAUQUA, ERIE, NIAGARA AND WYOMING 700 DELAWARE AVENUE BUFFALO, NY 14209-2999 TEL. (716) 851-7165 700 DELAWARE AVENUE BUFFALO, NY 14209-2999 TEL. (716) 851-7070 80 APPENDIX F – SWPPP Preparer Certification Form The SWPPP Preparer Certification Form required by this permit begins on the following page. 81 SWPPP Preparer Certification Form 63'(6*HQHUDO3HUPLWIRU6WRUPZDWHU'LVFKDUJHVIURP &RQVWUXFWLRQ$FWLYLW\*3 &*3 ,QDFFRUGDQFHZLWK&*33DUW,'EWKHFRPSOHWHGIRUPPXVWEHDWWDFKHGWRWKHH12,DQG VXEPLWWHGWR1<6'(&electronically 3URMHFW6LWH Name H12,6XEPLVVLRQ,' Owner/Operator Name Certification Statement – SWPPP Preparer I hereby certify that the Stormwater Pollution Prevention Plan (SWPPP)has been prepared in accordance with the requirements of GP-0-25-001. I certify under penalty of law that the SWPPP and all attachments were prepared under my direction or supervision in accordance with a system designed to assure that qualified personnel properly gather and evaluate the information submitted. Based on my inquiry of the person or persons who manage the system, or those persons directly responsible for gathering the information, the information submitted is, to the best of my knowledge and belief, true, accurate, and complete. ,DPDZDUHWKDWWKHUHDUHVLJQLILFDQW SHQDOWLHVIRUVXEPLWWLQJIDOVHLQIRUPDWLRQLQFOXGLQJWKHSRVVLELOLW\RIILQHDQG LPSULVRQPHQWIRUNQRZLQJYLRODWLRQV SWPPP Preparer First Name MI SWPPP Preparer Last Name Signature Date Revised:January 2025 APPENDIX G – MS4 SWPPP Acceptance Form The MS4 SWPPP Acceptance Form required by this permit begins on the following page. 83 MS4 SWPPP Acceptance Form for construction activities seeking authorization under the 63'(6*HQHUDO3HUPLWIRU6WRUPZDWHU'LVFKDUJHVIURP &RQVWUXFWLRQ$FWLYLW\*3 &*3 (,QDFFRUGDQFHZLWK&*3 3DUW,'EWKHFRPSOHWHGIRUPPXVWEHDWWDFKHGWRWKHH12, DQGVXEPLWWHGWR1<6'(&electronically.) I. Project Owner/Operator Information 1. Owner/Operator Name: 2. Contact Person: 3. Street Address: 4. City/State/Zip: II. Project Site Information 5. Project/Site Name: 6. Street Address: 7. City/State/Zip: III. Stormwater Pollution Prevention Plan (SWPPP) Review and Acceptance Information 8. SWPPP Reviewed by: 9. Title/Position: 10. Date Final SWPPP Reviewed and Accepted: IV. Regulated MS4 Information 11. Name of MS4 2SHUDWRU: 12. MS4 SPDES Permit Identification Number: NYR20A 13.6WUHHW$GGUHVV 14.&LW\6WDWH=LS: 15.7HOHSKRQH1XPEHU: 3DJHRI  MS4 SWPPP Acceptance Form continued V. Certification Statement - MS4 Official (principal executive officer or ranking elected official) or Duly Authorized Representative ,KHUHE\ FHUWLI\ WKDWWKHILQDO 6WRUPZDWHU 3ROOXWLRQ3UHYHQWLRQ3ODQ 6:333 IRU WKHFRQVWUXFWLRQSURMHFW LGHQWLILHGLQVHFWLRQ,, RIWKLVIRUPKDV EHHQUHYLHZHGDQGPHHWV WKHVXEVWDQWLYHUHTXLUHPHQWV LQWKH 63'(6*HQHUDO 3HUPLWIRU 6WRUPZDWHU 'LVFKDUJHV IURP &RQVWUXFWLRQ$FWLYLW\*3 (CGP) 1RWH7KH062SHUDWRUWKURXJKWKHDFFHSWDQFHRI WKH6:333 DVVXPHV QRUHVSRQVLELOLW\ IRU WKH DFFXUDF\ DQG DGHTXDF\RI WKHGHVLJQLQFOXGHGLQWKH6:333 ,QDGGLWLRQ UHYLHZDQGDFFHSWDQFHRI WKH6:333 E\ WKH06 2SHUDWRU GRHV QRWUHOLHYHWKHRZQHURSHUDWRU RU WKHLU6:333 SUHSDUHU RI UHVSRQVLELOLW\ RUOLDELOLW\ IRUHUURUV RU RPLVVLRQV LQWKHSODQ 3ULQWHG1DPH 7LWOH3RVLWLRQ 6LJQDWXUH 'DWH VI. Additional Information 3ULQWHGQDPHRIWKHSULQFLSDOH[HFXWLYHRIILFHURUUDQNLQJHOHFWHGRIILFLDOIRUWKH062SHUDWRURUWKHLU GXO\DXWKRUL]HGUHSUHVHQWDWLYHLQDFFRUGDQFHZLWK&*33DUW9,,- 1<6'(& 066:333 $FFHSWDQFH)RUP -DQXDU\2025) 3DJH RI  APPENDIX H – NYCDEP SWPPP Acceptance/Approval Form The City of New York Department of Environmental Protection (NYCDEP) SWPPP Acceptance/Approval form required by this permit begins on the following page. 86 THE CITY OF NEW YORK DEPARTMENT OF ENVIRONMENTAL PROTECTION Bureau of Environmental Planning and Analysis 59-17 Junction Blvd., 9th Floor; Flushing, NY 11373 SWPPP Acceptance/Approval Application Number: I. Project Owner/Operator Information 1. Owner/Operator Name: 2. Contact Person: 3. Street Address: 4. City/State/Zip: II. Project Site Information 5. Project/Site Name: 6. Street Address: 7. City/State/Zip: III. Stormwater Pollution Prevention Plan (SWPPP) Review and Acceptance/Approval 8. SWPPP Reviewed by: 9. Title/Position: / Date Final SWPPP Reviewed and Accepted: Acceptance/Approval Expiration Date: IV. Regulated MS4 Information for projects that require coverage under the NY State Pollution Discharge Elimination System General Permit for Stormwater Discharges from Construction Activity 12. Name of MS4: CITY OF NEW YORK 13. MS4 SPDES Permit Identification Number: NY-0287890 14. Contact Person: 15. Street Address: 59-17 Junction Blvd. 9th Floor 16. City/State/Zip: Flushing, NY 11373 17. Telephone Number: Projects in the MS4 area must submit a copy of this SWPPP Acceptance with a Notice of Intent for coverage under the NY SPDES General Permit for Stormwater Discharges from Construction Activity to: NYS Department of Environmental Conservation, Division of Water; 625 Broadway, 4th Floor; Albany, New York 12233-3505. Page 1 Of 2 THE CITY OF NEW YORK DEPARTMENT OF ENVIRONMENTAL PROTECTION Bureau of Environmental Planning and Analysis 59-17 Junction Blvd., 9th Floor; Flushing, NY 11373 V. Certification Statement - MS4 Official (principal executive officer or ranking elected official) or Duly Authorized Representative I hereby certify that the final Stormwater Pollution Prevention Plan (SWPPP) for the construction project identified in question 5 has been reviewed and meets the substantive requirements in the SPDES General Permit For Stormwater Discharges from Municipal Separate Storm Sewer Systems (MS4s). Note: The MS4, through the acceptance of the SWPPP, assumes no responsibility for the accuracy and adequacy of the design included in the SWPPP. In addition, review and acceptance of the SWPPP by the MS4 does not relieve the owner/operator or their SWPPP preparer of responsibility or liability for errors or omissions in the plan. Printed Name: Title/Position: Signature: Date: VI. Conditions of Acceptance/Approval and Additional Information Projects in the MS4 area must submit a copy of this SWPPP Acceptance with a Notice of Intent for coverage under the NY SPDES General Permit for Stormwater Discharges from Construction Activity to: NYS Department of Environmental Conservation, Division of Water; 625 Broadway, 4th Floor; Albany, New York 12233-3505. Page 2 Of 2 APPENDIX I – MS4 No Jurisdiction Form The MS4 No Jurisdiction Form required by this permit begins on the following page. 89 MS4 No Jurisdiction Form for Đonstruction Ăctivities seeking authorization under the SPDES General Permit for Stormwater Discharges from Construction Activity, GP-0-25-001 (CGP) (In accordance with CGP Part I.D.2.b., the completed form must be attached to the eNOI and submitted to NYSDEC ĞůĞĐƚƌŽŶŝĐĂůůLJ.) I. Project Owner/Operator Information a. Owner/Operator Name: b. Contact Person: c. Street Address: d. City/State/Zip: II. Project Site Information a. Project/Site Name: b. Street Address: c. City/State/Zip: d. eNOI Submission ID: III. Traditional Land Use Control MS4 Operator Information a. Name of MS4 Operator: b. MS4 SPDES Permit ID Number: NYR20A c. Street Address: d. City/State/Zip: e. Telephone Number: IV. Certification Statement In accordance with CGP Part I.D.2.b.ii.3., I hereby certify that the Traditional Land Use Control MS4 Operator identified in section III. of this form does not have review authority over the construction project identified in section II. of this form, which is owned/operated by the entity identified in section I. of this form. I am aware that there are significant penalties for submitting false information, including the possibility of fine and imprisonment for knowing violations. a. Printed name of the principal executive officer or ranking elected official for the MS4 Operator or their duly authorized representative in accordance with CGP Part VII.J.2.: b. Title/Position: c. Signature: d. Date: APPENDIX J – Owner/Operator Certification Form The Owner/Operator Certification Form required by this permit begins on the following page. 91 BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB 2ZQHU2SHUDWRU &HUWLILFDWLRQ)RUP 63'(6*HQHUDO3HUPLWIRU6WRUPZDWHU'LVFKDUJHVIURP &RQVWUXFWLRQ $FWLYLW\*3 &*3 ,QDFFRUGDQFHZLWK&*33DUW,'E RU3DUW,)DQGWKHFRPSOHWHGIRUPPXVWEHDWWDFKHGWRWKHH12,RUWKH 5HTXHVWWR&RQWLQXH&RYHUDJHDQGVXEPLWWHGWR1<6'(&electronically Project/Site Name: ________________________________________________________ eNOI Submission ,': _________________________________________________ eNOI Submitted by: Owner/Operator SWPPP Preparer Other Certification Statement - Owner/Operator ,KHUHE\FHUWLI\WKDW,UHDGDQGZLOOFRPSO\ZLWKWKH*3SHUPLWUHTXLUHPHQWV,XQGHUVWDQGWKDW DXWKRUL]DWLRQWRGLVFKDUJHXQGHUWKHSHUPLWIRUWKHSURMHFWVLWHQDPHGDERYHLVGHSHQGHQWRQUHFHLSWRID /HWWHURI$XWKRUL]DWLRQ (LOA)RUD/HWWHURI&RQWLQXHG&RYHUDJH(LOCC) IURPWKH1HZ<RUN6WDWH 'HSDUWPHQWRI(QYLURQPHQWDO&RQVHUYDWLRQ 1<6'(& LQDFFRUGDQFHZLWK&*33DUW,'ERU3DUW,) ,DPDZDUHWKDWWKHUHDUHVLJQLILFDQWSHQDOWLHVIRUVXEPLWWLQJIDOVHLQIRUPDWLRQLQFOXGLQJWKHSRVVLELOLW\RI ILQHDQGLPSULVRQPHQWIRUNQRZLQJYLRODWLRQV 2ZQHU2SHUDWRU )LUVW 1DPH0,2ZQHU2SHUDWRU /DVW 1DPH 6LJQDWXUH 'DWH 5HYLVHGJanuary 2025 Appendix J Historic Preservation/Endangered Species Documentation KATHY HOCHUL RANDY SIMONS Governor Commissioner Pro Tempore ______________________________________________________________________________________________________ Division for Historic Preservation P.O. Box 189, Waterford, New York 12188-0189 • (518) 237-8643 • parks.ny.gov December 10, 2024 Brittney Ciuffo Witt Construction, Inc. 563 North Broadway Saratoga Springs, NY 12866 Re: DEC JW Hemmingway 110-114 Nelson Avenue Saratoga Springs, NY 12866 110 Nelson Ave, Saratoga Springs, NY 12866 21PR02146 Dear Brittney Ciuffo: Thank you for continuing to consult with the Division for Historic Preservation of the Office of Parks, Recreation and Historic Preservation (OPRHP). We have reviewed the submitted materials in accordance with the New York State Historic Preservation Act of 1980 (Section 14.09 of the New York State Parks, Recreation and Historic Preservation Law). These comments are those of the Division for Historic Preservation and relate only to Historic/Cultural resources. The project is located directly adjacent to the State and National Register listed Union Avenue Historic District and the listed Saratoga Racetrack (Racetrack). Our previous review and impact finding, dated May 25, 2022, was based on a proposed three-lot subdivision and new single-family housing along Nelson Avenue. The latest submission appears to include the full buildout of the site, located between Nelson Ave and Frank Sullivan Place, for single and multi-family housing. The previous concept plan, dated March 25, 2021, illustrates a proposed buildout consisting of multiple two and two and 1/2 -story houses designed to reference the Queen Ann Victorian style. The most recent plan calls for construction of substantially larger and more massive structures- rising to four stories- along Frank Sullivan Place. This location overlooks the National Register listed Racetrack located directly across from Frank Sullivan Place. We are concerned that the taller more massive buildings will be substantially visible from the Racetrack and threaten to negatively impact its historically significant appearance and setting. To minimize impacts to the Racetrack and other adjacent historic resources, we recommend that the buildings be limited in height, as previously proposed. In addition, the massing of the larger structures should be divided to resemble that of the typical surrounding single-family home. The Victorian design concept appears to be generally appropriate, though we recommend avoiding overly ornate trim, roof, porch, and other decorative elements. Detailed information describing cladding materials and colors should be provided to our office for review as well. ______________________________________________________________________________________________________ Division for Historic Preservation P.O. Box 189, Waterford, New York 12188-0189 • (518) 237-8643 • parks.ny.gov In order for our office to continue this review, please provided additional information in response to our comments and requests above. Please respond to our request using the link provided in this CRIS communication. If you have any questions, I can be reached via email or at (518) 268-2164. Sincerely, Weston Davey Historic Site Restoration Coordinator Weston.davey@parks.ny.gov Nelson Ave Subdivision New York State, Maxar, Esri, HERE, Garmin, iPC August 20, 2025 0 0.08 0.160.04 mi 0 0.1 0.20.05 km 1:4,514 Author: The LA Group Not a legal document Appendix K Deep Ripping and De-compaction (DEC, 2008) DE P A R T M E N T O F E N V I R O N M E N T A L C O N S E R V A T I O N N e w Y o r k S t a t e De e p - R i p p i n g a n d De c o m p a c t i o n Ne w Y o r k S t a t e De p a r t m e n t o f E n v i r o n m e n t a l C o n s e r v a t i o n Di v i s i o n o f W a t e r Ap r i l 2 0 0 8 Do c u m e n t P r e p a r e d b y : Jo h n E . L a c e y , La n d R e s o u r c e C o n s u l t a n t a n d E n v i r o n m e n t a l C o m p l i a n c e M o n i t o r (F o r m e r l y w i t h t h e D i v i s i o n o f A g r i c u l t u r a l P r o t e c t i o n a n d D e v e l o p m e n t S e r v i c e s , NY S D e p t . o f A g r i c u l t u r e & M a r k e t s ) 1 Al t e r n a t i v e ȱSt o r m w a t e r ȱMa n a g e m e n t ȱ De e p ȬRi p p i n g ȱan d ȱDe c o m p a c t i o n ȱ ȱȱ ȱ ȱ ȱ ȱ ȱ ȱ ȱ De s c r i p t i o n Th e t w o - p h a s e p r a c t i c e o f 1 ) “ D e e p R i p p i n g ; ” a n d 2 ) “ D e c o m p a c t i o n ” ( d e e p s u b s o i l i n g ) , o f t h e so i l m a t e r i a l a s a s t e p i n t h e c l e a n u p a n d r e s t o r a t i o n / l a n d s c a p i n g o f a c o n s t r u c t i o n s i t e , h e l p s mi t i g a t e t h e p h y s i c a l l y i n d u c e d i m p a c t s o f s o i l c o m p r e s s i o n ; i . e . : s o i l c o m p a c t i o n o r t h e su b s t a n t i a l i n c r e a s e i n t h e b u l k d e n s i t y o f t h e s o i l m a t e r i a l . De e p R i p p i n g a n d D e c o m p a c t i o n a r e k e y f a c t o r s w h i c h h e l p i n r e s t o r i n g s o i l p o r e s p a c e a n d pe r m e a b i l i t y f o r w a t e r i n f i l t r a t i o n . C o n v e r s e l y , t h e p h y s i c a l a c t i o n s o f c u t - a n d - f i l l w o r k , l a n d gr a d i n g , t h e o n g o i n g m o v e m e n t o f c o n s t r u c t i o n e q u i p m e n t a n d t h e t r a n s p o r t o f b u i l d i n g ma t e r i a l s t h r o u g h o u t a s i t e a l t e r t h e a r c h i t e c t u r e a n d s t r u c t u r e o f t h e s o i l , r e s u l t i n g i n : t h e m i x i n g of l a y e r s ( h o r i z o n s ) o f s o i l m a t e r i a l s , c o m p r e s s i o n o f t h o s e m a t e r i a l s a n d d i m i n i s h e d s o i l po r o s i t y w h i c h , i f l e f t u n c h e c k e d , s e v e r e l y i m p a i r s t h e s o i l ’ s w a t e r h o l d i n g c a p a c i t y a n d v e r t i c a l dr a i n a g e ( r a i n f a l l i n f i l t r a t i o n ) , f r o m t h e s u r f a c e d o w n w a r d . In a h u m i d c l i m a t e r e g i o n , c o m p a c t i o n d a m a g e o n a s i t e i s v i r t u a l l y g u a r a n t e e d o v e r t h e d u r a t i o n of a p r o j e c t . S o i l i n v e r y m o i s t t o w e t c o n d i t i o n w h e n c o m p a c t e d , w i l l h a v e s e v e r e l y r e d u c e d pe r m e a b i l i t y . F i g u r e 1 d i s p l a y s t h e e a r l y s t a g e o f t h e d e e p - r i p p i n g p h a s e ( N o t e t h a t a l l t o p s o i l wa s s t r i p p e d p r i o r t o c o n s t r u c t i o n a c c e s s , a n d i t r e m a i n s s t o c k p i l e d u n t i l t h e n e x t p h a s e – de c o m p a c t i o n – i s c o m p l e t e ) . A h e a v y - d u t y t r a c t o r i s p u l l i n g a t h r e e - s h a n k r i p p e r o n t h e f i r s t o f se v e r a l s e r i e s o f i n c r e m e n t a l l y d e e p e n i n g p a s s e s t h r o u g h t h e c o n s t r u c t i o n a c c e s s c o r r i d o r ' s de n s e l y c o m p r e s s e d s u b s o i l m a t e r i a l . F i g u r e 2 i l l u s t r a t e s t h e a p p r o x i m a t e v o l u m e t r i c co m p o s i t i o n o f a l o a m s u r f a c e s o i l w h e n c o n d i t i o n s a r e g o o d f o r p l a n t g r o w t h , w i t h a d e q u a t e na t u r a l p o r e s p a c e f o r f l u c t u a t i n g m o i s t u r e c o n d i t i o n s . ȱ Fi g . 1 . A t y p i c a l d e e p r i p p i n g ph a s e o f t h i s pr a c t i c e , d u r i n g t h e f i r s t i n a s e r i e s o f pr o g r e s s i v e l y d e e p e r “ r i p s ” t h r o u g h s e v e r e l y co m p r e s s e d s u b s o i l . Fi g . 2 . A b o u t 5 0 % o f t h e v o l u m e o f u n d i s t u r b e d lo a m s u r f a c e s o i l i s p o r e s p a c e , w h e n s o i l i s i n go o d c o n d i t i o n f o r p l a n t g r o w t h . B r a d y , 2 0 0 2 . 2 Re c o m m e n d e d A p p l i c a t i o n o f P r a c t i c e Th e ȱob j e c t i v e o f D e e p R i p p i n g a n d De c o m p a c t i o n i s t o e f f e c t i v e l y f r a c t u r e (v e r t i c a l l y a n d l a t e r a l l l y ) t h r o u g h t h e t h i c k n e s s of t h e p h y s i c a l l y c o m p r e s s e d s u b s o i l m a t e r i a l (s e e F i g u r e 3 ) , r e s t o r i n g s o i l p o r o s i t y a n d pe r m e a b i l i t y a n d a i d i n g i n f i l t r a t i o n t o h e l p re d u c e r u n o f f . T o g e t h e r w i t h t o p s o i l s t r i p p i n g , th e “ t w o - p h a s e ” p r a c t i c e o f D e e p R i p p i n g a n d De c o m p a c t i o n f i r s t b e c a m e e s t a b l i s h e d a s a “ b e s t ma n a g e m e n t p r a c t i c e ” t h r o u g h o n g o i n g s u c c e s s on c o m m e r c i a l f a r m l a n d s a f f e c t e d b y h e a v y ut i l i t y c o n s t r u c t i o n r i g h t - o f - w a y p r o j e c t s (t r a n s m i s s i o n p i p e l i n e s a n d l a r g e p o w e r l i n e s ) . So i l p e r m e a b i l i t y , s o i l d r a i n a g e a n d c r o p l a n d pr o d u c t i v i t y w e r e r e s t o r e d . F o r b r o a d e r co n s t r u c t i o n a p p l i c a t i o n , t h e t w o - p h a s e p r a c t i c e o f D e e p R i p p i n g a n d D e c o m p a c t i o n i s b e s t ad a p t e d t o a r e a s i m p a c t e d w i t h s i g n i f i c a n t s o i l c o m p a c t i o n , o n c o n t i g u o u s o p e n p o r t i o n s o f l a r g e co n s t r u c t i o n s i t e s a n d i n s i d e l o n g , o p e n c o n s t r u c t i o n c o r r i d o r s u s e d a s t e m p o r a r y a c c e s s o v e r t h e du r a t i o n o f c o n s t r u c t i o n . E a c h m i t i g a t i o n a r e a s h o u l d h a v e m i n i m a l a b o v e - a n d - b e l o w - g r o u n d ob s t r u c t i o n s f o r t h e e a s y a v o i d a n c e a n d m a n e u v e r i n g o f a l a r g e t r a c t o r a n d r i p p i n g / d e c o m p a c t i n g im p l e m e n t s . C o n v e r s e l y , t h e c o m p l e t e t w o - p h a s e p r a c t i c e i s n o t r e c o m m e n d e d i n c o n g e s t e d o r ob s t r u c t e d a r e a s d u e t o t h e l i m i t a t i o n s o n t r a c t o r a n d i m p l e m e n t m o v e m e n t . Be n e f i t s Ag g r e s s i v e “ d e e p r i p p i n g ” t h r o u g h t h e c o m p r e s s e d t h i c k n e s s o f e x p o s e d s u b s o i l b e f o r e t h e re p l a c e m e n t / r e s p r e a d i n g o f t h e t o p s o i l l a y e r , f o l l o w e d b y “ d e c o m p a c t i o n , ” i . e . : “ s u b - s o i l i n g , ” th r o u g h t h e r e s t o r e d t o p s o i l l a y e r d o w n i n t o t h e s u b s o i l , o f f e r s t h e f o l l o w i n g b e n e f i t s : x In c r e a s e s t h e p r o j e c t ( l a r g e r s i z e ) a r e a ’ s d i r e c t s u r f a c e i n f i l t r a t i o n o f r a i n f a l l b y pr o v i d i n g t h e o p e n s i t e ’ s m i t i g a t e d s o i l c o n d i t i o n a n d l o w e r s t h e d e m a n d o n co n c e n t r a t e d r u n o f f c o n t r o l s t r u c t u r e s x En h a n c e s d i r e c t g r o u n d w a t e r r e c h a r g e t h r o u g h g r e a t e r d i s p e r s i o n a c r o s s a n d t h r o u g h a br o a d e r s u r f a c e t h a n a f f o r d e d b y s o m e r u n o f f - c o n t r o l s t r u c t u r a l m e a s u r e s x De c r e a s e s r u n o f f v o l u m e g e n e r a t e d a n d p r o v i d e s h y d r o l o g i c s o u r c e c o n t r o l x Ma y b e p l a n n e d f o r a p p l i c a t i o n i n f e a s i b l e o p e n l o c a t i o n s e i t h e r a l o n e o r i n Fi g . 3 . C o n s t r u c t i o n s i t e w i t h s i g n i f i c a n t co m p a c t i o n o f t h e d e e p b a s a l t i l l s u b s o i l ex t e n d s 2 4 i n c h e s b e l o w t h i s e x p o s e d c u t - an d - f i l l w o r k s u r f a c e . 3 co n j u n c t i o n w i t h p l a n s f o r s t r u c t u r a l p r a c t i c e s ( e . g . , s u b s u r f a c e d r a i n l i n e o r in f i l t r a t i o n b a s i n ) s e r v i n g t h e s a m e o r c o n t i g u o u s a r e a s x Pr o m o t e s s u c c e s s f u l l o n g - t e r m r e v e g e t a t i o n b y r e s t o r i n g s o i l p e r m e a b i l i t y , d r a i n a g e a n d wa t e r h o l d i n g c a p a c i t y f o r h e a l t h y ( r a t h e r t h a n r e s t r i c t e d ) r o o t - s y s t e m d e v e l o p m e n t o f tr e e s , s h r u b s a n d d e e p r o o t e d g r o u n d c o v e r , m i n i m i z i n g p l a n t d r o w n i n g d u r i n g w e t pe r i o d s a n d b u r n o u t d u r i n g d r y p e r i o d s . Fe a s i b i l i t y / L i m i t a t i o n s Th e e f f e c t i v e n e s s o f D e e p R i p p i n g a n d D e c o m p a c t i o n i s g o v e r n e d m o s t l y b y s i t e f a c t o r s s u c h a s : th e o r i g i n a l ( u n d i s t u r b e d ) s o i l ’ s h y d r o l o g i c c h a r a c t e r i s t i c s ; t h e g e n e r a l s l o p e ; l o c a l w e a t h e r / t i m i n g (s o i l m o i s t u r e ) f o r i m p l e m e n t a t i o n ; t h e s p a c e - r e l a t e d f r e e d o m o f e q u i p m e n t / i m p l e m e n t ma n e u v e r a b i l i t y ( n o t e d a b o v e i n Re c o m m e n d e d A p p l i c a t i o n o f P r a c t i c e ), a n d b y t h e p r o p e r se l e c t i o n a n d o p e r a t i o n o f t r a c t o r a n d i m p l e m e n t s ( e x p l a i n e d b e l o w i n De s i g n G u i d a n c e ). T h e mo r e n o t a b l e s i t e - r e l a t e d f a c t o r s i n c l u d e : So i l In t h e u n d i s t u r b e d c o n d i t i o n , e a c h i d e n t i f i e d s o i l t y p e c o m p r i s i n g a s i t e i s g r o u p e d i n t o o n e o f fo u r c a t e g o r i e s o f s o i l h y d r o l o g y , H y d r o l o g i c S o i l G r o u p A , B , C o r D , d e t e r m i n e d p r i m a r i l y b y a ra n g e o f c h a r a c t e r i s t i c s i n c l u d i n g s o i l t e x t u r e , d r a i n a g e c a p a b i l i t y w h e n t h o r o u g h l y w e t , a n d d e p t h to w a t e r t a b l e . T h e n a t u r a l r a t e s o f i n f i l t r a t i o n a n d t r a n s m i s s i o n o f s o i l - w a t e r t h r o u g h t h e un d i s t u r b e d s o i l l a y e r s f o r G r o u p A i s “ h i g h ” w i t h a l o w r u n o f f p o t e n t i a l w h i l e s o i l s i n G r o u p B ar e m o d e r a t e i n i n f i l t r a t i o n a n d t h e t r a n s m i s s i o n o f s o i l - w a t e r w i t h a m o d e r a t e r u n o f f p o t e n t i a l , de p e n d i n g s o m e w h a t o n s l o p e . S o i l s i n G r o u p C h a v e s l o w r a t e s o f i n f i l t r a t i o n a n d t r a n s m i s s i o n of s o i l - w a t e r a n d a m o d e r a t e l y h i g h r u n o f f p o t e n t i a l i n f l u e n c e d b y s o i l t e x t u r e a n d s l o p e ; w h i l e so i l s i n G r o u p D h a v e e x c e p t i o n a l l y s l o w ra t e s o f i n f i l t r a t i o n a n d t r a n s m i s s i o n o f s o i l - wa t e r , a n d h i g h r u n o f f p o t e n t i a l . In F i g u r e 4 , t h e p r o f i l e d i s p l a y s t h e un d i s t u r b e d h o r i z o n s o f a s o i l i n H y d r o l o g i c So i l G r o u p C a n d t h e n a t u r a l l y s l o w r a t e o f in f i l t r a t i o n t h r o u g h t h e s u b s o i l . T h e s l o w r a t e of i n f i l t r a t i o n b e g i n s i m m e d i a t e l y b e l o w t h e to p s o i l h o r i z o n ( 3 0 c m ) , d u e t o t h e l i m i t e d am o u n t o f m a c r o p o r e s , e . g . : n a t u r a l s u b s o i l fr a c t u r e s , w o r m h o l e s a n d r o o t c h a n n e l s . In f i l t r a t i o n a f t e r t h e c o n s t r u c t i o n - i n d u c e d mi x i n g a n d c o m p r e s s i o n o f s u c h s u b s o i l ma t e r i a l i s v i r t u a l l y a b s e n t ; b u t c a n b e re s t o r e d b a c k t o t h i s n a t u r a l l e v e l w i t h t h e tw o - p h a s e p r a c t i c e o f d e e p r i p p i n g a n d de c o m p a c t i o n , f o l l o w e d b y t h e p e r m a n e n t es t a b l i s h m e n t o f a n a p p r o p r i a t e , d e e p t a p r o o t Fi g . 4 . P r o f i l e ( i n c e n t i m e t e r s ) d i s p l a y i n g t h e in f i l t r a t i o n t e s t r e s u l t o f t h e n a t u r a l u n d i s t u r b e d ho r i z o n s o f a s o i l i n H y d r o l o g i c S o i l G r o u p C . 4 la w n / g r o u n d c o v e r t o h e l p m a i n t a i n t h e r e s t o r e d s u b s o i l s t r u c t u r e . I n f i l t r a t i o n a f t e r c o n s t r u c t i o n - in d u c e d m i x i n g a n d c o m p r e s s i o n o f s u c h s u b s o i l m a t e r i a l c a n b e n o t a b l y r e h a b i l i t a t e d w i t h t h e De e p R i p p i n g a n d D e c o m p a c t i o n p r a c t i c e , w h i c h p r e p a r e s t h e s i t e f o r t h e a p p r o p r i a t e l o n g - t e r m la w n / g r o u n d c o v e r m i x i n c l u d i n g d e e p t a p r o o t p l a n t s s u c h a s c l o v e r , f e s c u e o r t r e f o i l , e t c . n e e d e d fo r a l l r e h a b i l i t a t e d s o i l s . Ge n e r a l l y , s o i l s i n H y d r o l o g i c S o i l G r o u p s A a n d B , w h i c h r e s p e c t i v e l y m a y i n c l u d e d e e p , w e l l - dr a i n e d , s a n d y - g r a v e l l y m a t e r i a l s o r d e e p , m o d e r a t e l y w e l l - d r a i n e d b a s a l t i l l m a t e r i a l s , a r e a m o n g th e e a s i e r o n e s t o r e s t o r e p e r m e a b i l i t y a n d i n f i l t r a t i o n , b y d e e p r i p p i n g a n d d e c o m p a c t i o n . A m o n g th e m a n y d i f f e r e n t s o i l s i n H y d r o l o g i c S o i l G r o u p C a r e t h o s e u n i q u e g l a c i a l t i l l s h a v i n g a n a t u r a l fr a g i p a n z o n e , b e g i n n i n g a b o u t 1 2 t o 1 8 i n c h e s ( 3 0 – 4 5 c m ) , b e l o w s u r f a c e . A l t h o u g h s o i l s i n Hy d r o l o g i c S o i l G r o u p C d o r e q u i r e a s o m e w h a t m o r e c a r e f u l l y a p p l i e d l e v e l o f t h e D e e p R i p p i n g an d D e c o m p a c t i o n p r a c t i c e , i t c a n g r e a t l y b e n e f i t s u c h a f f e c t e d a r e a s b y r e d u c i n g t h e r u n o f f a n d fo s t e r i n g i n f i l t r a t i o n t o a l e v e l e q u a l t o t h a t o f p r e - d i s t u r b a n c e . So i l s i n H y d r o l o g i c S o i l G r o u p D t y p i c a l l y h a v e a p e r m a n e n t h i g h w a t e r t a b l e c l o s e t o t h e s u r f a c e , in f l u e n c e d b y a c l a y o r o t h e r h i g h l y i m p e r v i o u s l a y e r o f m a t e r i a l . I n m a n y l o c a t i o n s w i t h c l a y su b s o i l m a t e r i a l , t h e b u l k d e n s i t y i s s o n a t u r a l l y h i g h t h a t h e a v y t r a f f i c k i n g h a s l i t t l e o r n o a d d e d im p a c t o n i n f i l t r a t i o n ; a n d s t r u c t u r a l r u n o f f c o n t r o l p r a c t i c e s r a t h e r t h a n D e e p R i p p i n g a n d De c o m p a c t i o n s h o u l d b e c o n s i d e r e d . Th e i n f o r m a t i o n a b o u t H y d r o l o g i c S o i l G r o u p s i s m e r e l y a g e n e r a l g u i d e l i n e . S i t e - s p e c i f i c d a t a su c h a s l i m i t e d d e p t h s o f c u t - a n d - f i l l g r a d i n g w i t h m i n i m a l r e m o v a l o r t r a n s l o c a t i o n o f t h e i n h e r e n t su b s o i l m a t e r i a l s ( a s a n a l y z e d i n t h e c o u n t y s o i l s u r v e y ) o r , c o n v e r s e l y , t h e e x c a v a t i o n a n d tr a n s l o c a t i o n o f d e e p e r , u n c o n s o l i d a t e d s u b s t r a t u m o r c o n s o l i d a t e d b e d r o c k m a t e r i a l s ( u n l i k e t h e an a l y z e d s u b s o i l h o r i z o n s ’ m a t e r i a l s r e f e r r e d t o i n t h e c o u n t y s o i l s u r v e y ) s h o u l d a l w a y s b e t a k e n in t o a c c o u n t . Si t e s m a d e u p w i t h s i g n i f i c a n t q u a n t i t i e s o f l a r g e r o c k s , o r h a v i n g a v e r y s h a l l o w d e p t h t o b e d r o c k , ar e n o t c o n d u c i v e t o d e e p r i p p i n g a n d d e c o m p a t i o n ( s u b s o i l i n g ) ; a n d o t h e r m e a s u r e s m a y b e m o r e pr a c t i c a l . Sl o p e Th e t w o - p h a s e a p p l i c a t i o n o f 1 ) d e e p r i p p i n g a n d 2 ) d e c o m p a c t i o n ( d e e p s u b s o i l i n g ) , i s m o s t pr a c t i c a l o n f l a t , g e n t l e a n d m o d e r a t e s l o p e s . I n s o m e s i t u a t i o n s , s u c h a s b u t n o t l i m i t e d t o te m p o r a r y c o n s t r u c t i o n a c c e s s c o r r i d o r s , i n c l u s i o n a r e a s t h a t a r e m o d e r a t e l y s t e e p a l o n g a p r o j e c t ’ s ot h e r w i s e g e n t l e o r m o d e r a t e s l o p e m a y a l s o b e d e e p r i p p e d a n d d e c o m p a c t e d . F o r l i m i t e d in s t a n c e s o f m o d e r a t e s t e e p n e s s o n o t h e r p r o j e c t s , h o w e v e r , t h e p o s t - c o n s t r u c t i o n l a n d u s e a n d t h e re l a t i v e a l i g n m e n t o f t h e p o t e n t i a l r i p p i n g a n d d e c o m p a c t i o n w o r k i n r e l a t i o n t o t h e l a y o f t h e sl o p e s h o u l d b e r e v i e w e d f o r s a f e t y a n d p r a c t i ca l i t y . I n b r o a d c o n s t r u c t i o n a r e a s p r e d o m i n a t e d b y mo d e r a t e l y s t e e p o r s t e e p s l o p e s , t h e p r a c t i c e i s g e n e r a l l y n o t u s e d . Lo c a l W e a t h e r / T i m i n g / S o i l M o i s t u r e Ef f e c t i v e f r a c t u r i n g o f c o m p r e s s e d s u b s o i l m a t e r i a l f r o m t h e e x p o s e d w o r k s u r f a c e , l a t e r a l l y a n d ve r t i c a l l y d o w n t h r o u g h t h e a f f e c t e d z o n e i s a c h i e v e d o n l y w h e n t h e s o i l m a t e r i a l i s m o d e r a t e l y dr y t o m o d e r a t e l y m o i s t . N e i t h e r o n e o f t h e t w o - p h a s e s , d e e p r i p p i n g n o r d e c o m p a c t i o n ( d e e p 5 Fi g . 5 . A u g e r e d f r o m a d e p t h o f 1 9 i n c h e s be l o w t h e s u r f a c e o f t h e r e p l a c e d t o p s o i l , th i s s u b s o i l s a m p l e w a s h a n d r o l l e d t o a 1/ 8 - i n c h d i a m e t e r . T h e t e s t s h o w s t h e s o i l a t th i s s i t e s t r e t c h e s o u t t o o f a r w i t h o u t cr u m b l i n g ; i t i n d i c a t e s t h e m a t e r i a l i s i n a pl a s t i c s t a t e o f c o n s i s t e n c e , t o o w e t f o r f i n a l de c o m pac t i o n (de e p s u b s o i l i n g) a t t h i s t i m e . su b s o i l i n g ) , c a n b e e f f e c t i v e l y c o n d u c t e d w h e n t h e s o i l m a t e r i a l ( s u b s o i l o r r e p l a c e d t o p s o i l ) i s i n ei t h e r a “ p l a s t i c ” o r “ l i q u i d ” s t a t e o f s o i l c o n s i s t e n c y . P u l l i n g t h e r e s p e c t i v e i m p l e m e n t s l e g s th r o u g h t h e s o i l w h e n i t i s o v e r l y m o i s t o n l y r e s u l t s i n t h e “ s l i c i n g a n d s m e a r i n g ” o f t h e m a t e r i a l o r ad d e d “ s q u e e z i n g a n d c o m p r e s s i o n ” i n s t e a d o f t h e n e c e s s a r y f r a c t u r i n g . A m p l e d r y i n g t i m e i s ne e d e d f o r a “ r i p p a b l e ” s o i l c o n d i t i o n n o t m e r e l y i n t h e m a t e r i a l c l o s e t o t h e s u r f a c e , b u t th r o u g h o u t t h e m a t e r i a l l o c a t e d d o w n t o t h e b o t t o m o f t h e p h y s i c a l l y c o m p r e s s e d z o n e o f t h e su b s o i l . Th e “ p o o r m a n ’ s A t t e r b e r g f i e l d t e s t ” f o r s o i l pl a s t i c i t y i s a s i m p l e “ h a n d - r o l l ” m e t h o d u s e d fo r q u i c k , o n - s i t e d e t e r m i n a t i o n o f w h e t h e r o r no t t h e m o i s t u r e l e v e l o f t h e a f f e c t e d s o i l ma t e r i a l i s l o w e n o u g h f o r : e f f e c t i v e d e e p ri p p i n g o f s u b s o i l ; r e s p r e a d i n g o f t o p s o i l i n a fr i a b l e s t a t e ; a n d f i na l d e c o m p a c t i o n ( d e e p su b s o i l i n g ) . U s i n g a s a m p l e o f s o i l m a t e r i a l ob t a i n e d f r o m t h e p l a n n e d b o t t o m d e p t h o f ri p p i n g , e . g . : 2 0 - 2 4 i n c h e s b e l o w e x p o s e d su b s o i l s u r f a c e , t h e s a m p l e i s h a n d r o l l e d be t w e e n t h e p a l m s d o w n t o a 1 / 8 - i n c h d i a m e t e r th r e a d . ( U s e t h e s a m e t e s t f o r s t o r e d t o p s o i l ma t e r i a l b e f o r e r e s p r e a d i n g o n t h e s i t e . ) I f t h e re s p e c t i v e s o i l s a m p l e c r u m b l e s a p a r t i n se g m e n t s n o g r e a t e r t h a n 3 / 8 o f a n i n c h l o n g , b y th e t i m e i t i s r o l l e d d o w n t o 1 / 8 i n c h d i a m e t e r , i t is l o w e n o u g h i n m o i s t u r e f o r d e e p r i p p i n g ( o r to p s o i l r e p l a c e m e n t ) , a n d d e c o m p a c t i o n . Co n v e r s e l y , a s s h o w n i n F i g u r e 5 , i f t h e r o l l e d sa m p l e s t r e t c h e s o u t i n i n c r e m e n t s g r e a t e r t h a n 3/ 8 o f a n i n c h l o n g b e f o r e c r u m b l i n g , i t i s i n a “ p l a s t i c ” s t a t e o f s o i l c o n s i s t e n c y a n d i s t o o w e t f o r su b s o i l r i p p i n g ( a s w e l l a s t o p s o i l r e p l a c e m e n t ) a n d f i n a l d e c o m p a c t i o n . De s i g n G u i d a n c e Be y o n d t h e a b o v e - n o t e d s i t e f a c t o r s , a v i t a l r e q u i r e m e n t f o r t h e e f f e c t i v e D e e p R i p p i n g a n d De c o m p a c t i o n ( d e e p s u b s o i l i n g ) , i s i m p l e m e n t i n g t h e p r a c t i c e i n i t s d i s t i n c t , t w o - p h a s e p r o c e s s : 1) D e e p r i p t h e a f f e c t e d t h i c k n e s s o f e x p o s e d s u b s o i l m a t e r i a l ( s e e F i g u r e 1 0 a n d 1 1 ) , a g g r e s s i v e l y fr a c t u r i n g i t b e f o r e t h e p r o t e c t e d t o p s o i l i s r e a p p l i e d o n t h e s i t e ( s e e F i g u r e 1 2 ) ; a n d 2) D e c o m p a c t ( d e e p s u b s o i l ) , s i m u l t a n e o u s l y t h r o u g h t h e r e s t o r e d t o p s o i l l a y e r a n d t h e u p p e r h a l f of t h e a f f e c t e d s u b s o i l ( F i g u r e 1 3 ) . T h e s e c o n d p h a s e , “ d e c o m p a c t i o n , ” m i t i g a t e s t h e p a r t i a l re c o m p a c t i o n w h i c h o c c u r s d u r i n g t h e h e a v y p r o c e s s o f t o p s o i l s p r e a d i n g / g r a d i n g . P r i o r t o d e e p ri p p i n g a n d d e c o m p a c t i n g t h e s i t e , a l l c o n s t r u c t i o n a c t i v i t y , i n c l u d i n g c o n s t r u c t i o n e q u i p m e n t a n d ma t e r i a l s t o r a g e , s i t e c l e a n u p a n d t r a f f i c k i n g ( F i g u r e 1 4 ) , s h o u l d b e f i n i s h e d ; a n d t h e s i t e c l o s e d o f f to f u r t h e r d i s t u r b a n c e . L i k e w i s e , o n c e t h e p r a c t i c e i s u n d e r w a y a n d t h e a r e a ’ s s o i l p e r m e a b i l i t y a n d 6 Fi g . 6 . A l i g h t d u t y c h i s e l i m p l e m e n t , n o t ad e q u a t e f o r e i t h e r t h e d e e p r i p p i n g o r de c o m p a c t i o n ( d e e p s u b s o i l i n g ) p h a s e . ra i n f a l l i n f i l t r a t i o n a r e b e i n g r e s t o r e d , a p o l i c y l i m i t i ng a l l f u r t h e r t r a f f i c t o p e r m a n e n t t r a v e l l a n e s is m a i n t a i n e d . Th e o t h e r c r i t i c a l e l e m e n t s , o u t l i n e d b e l o w , a r e : u s i n g t h e p r o p e r i m p l e m e n t s ( d e e p , h e a v y - d u t y ri p p e r s a n d s u b s o i l e r s ) , a n d a m p l e p u l l i n g - p o w e r e q u i p m e n t ( t r a c t o r s ) ; a n d c o n d u c t i n g t h e p r a c t i c e at t h e a p p r o p r i a t e s p e e d , d e p t h a n d p a t t e r n ( s ) o f m o v e m e n t . No t e t h a t a n a p p r o p r i a t e p l a n f o r t h e s e p a r a t e p r a c t i c e o f e s t a b l i s h i n g a h e a l t h y p e r e n n i a l g r o u n d co v e r , w i t h d e e p r o o t i n g t o h e l p m a i n t a i n t h e r e s t o r e d s o i l s t r u c t u r e , s h o u l d b e d e v e l o p e d i n ad v a n c e . T h i s m a y r e q u i r e t h e a s s i s t a n c e o f a n a g r o n o m i s t o r l a n d s c a p e h o r t i c u l t u r i s t . Im p l e m e n t s Av o i d t h e u s e o f a l l u n d e r s i z e i m p l e m e n t s . T h e s m a l l - t o - m e d i u m , l i g h t - d u t y t o o l w i l l , a t b e s t , o n l y “s c a r i f y ” t h e u p p e r m o s t s u r f a c e p o r t i o n o f t h e m a s s o f c o m p a c t e d s u b s o i l m a t e r i a l . T h e t e r m “c h i s e l p l o w ” i s c o m m o n l y b u t i n c o r r e c t l y a p p l i e d t o a b r o a d r a n g e o f i m p l e m e n t s . W h i l e a f e w ma y b e a d a p t e d f o r t h e m o d e r a t e s u b s o i l i n g o f n o n - i m p a c t e d s o i l s , t h e m a j o r i t y a r e l e s s d u r a b l e an d u s e d f o r o n l y l i g h t e r l a n d - f i t t i n g ( s e e F i g u r e 6 ) . Us e a “ h e a v y d u t y ” a g r i c u l t u r a l - g r a d e , d e e p r i p p e r ( s e e F i g u r e s 7 , 9 , 1 0 a n d 1 1 ) f o r t h e f i r s t p h a s e : th e l a t e r a l a n d v e r t i c a l f r a c t u r i n g o f t h e m a s s o f e x p o s e d a n d c o m p r e s s e d s u b s o i l , d o w n a n d th r o u g h , t o t h e b o t t o m o f i m p a c t , p r i o r t o t h e r e p l a c e m e n t o f t h e t o p s o i l l a y e r . ( A n y o v e r s i z e r o c k s wh i c h a r e u p l i f t e d t o t h e s u b s o i l s u r f a c e d u r i n g t h e d e e p r i p p i n g p h a s e a r e p i c k e d a n d r e m o v e d . ) Li k e t h e h e a v y - d u t y c l a s s o f i m p l e m e n t f o r t h e f i r s t p h a s e , t h e d e c o m p a c t i o n ( d e e p s u b s o i l i n g ) o f Ph a s e 2 i s c o n d u c t e d w i t h t h e h e a v y - d u t y v e r s i o n o f t h e d e e p s u b s o i l e r . M o r e p r e f e r a b l e i s t h e an g l e d - l e g v a r i e t y o f d e e p s u b s o i l e r ( s h o w n i n F i g u r e s 8 a n d 1 3 ) . I t m i n i m i z e s t h e i n v e r s i o n o f t h e su b s o i l a n d t o p s o i l l a y e r s w h i l e l a t e r a l l y a n d v e r t i c a l l y f r a c t u r i n g t h e u p p e r h a l f o f t h e p r e v i o u s l y ri p p e d s u b s o i l l a y e r a n d a l l o f t h e t o p s o i l l a y e r b y d e l i v e r i n g a m o m e n t a r y , w a v e - l i k e “ l i f t i n g a n d sh a t t e r i n g ” a c t i o n u p t h r o u g h t h e s o i l l a y e r s a s i t i s p u l l e d . Fi g . 7 . O n e o f s e v e r a l v a r i a t i o n s o f a n ag r i c u l t u r a l r i p p e r . T h i s u n i t h a s l o n g , r u g g e d sh a n k s m o u n t e d o n a s t e e l V - f r a m e f o r d e e p , agg re s s i v e f r a c t u r i n g t h r o u gh P h a s e 1 . 7 Fi g . 8 . A d e e p , a n g l e d - l e g s u b s o i l e r , i d e a l f o r Ph a s e 2 d e c o m p a c t i o n o f a f t e r t h e t o p s o i l l a y e r is g r a d e d o n t o p o f t h e r i p p e d s u b s o i l . Pu l l i n g - P o w e r o f E q u i p m e n t Us e t h e f o l l o w i n g r u l e o f t h u m b f o r t r a c t o r h o r s e p o w e r ( h p ) w h e n e v e r d e e p r i p p i n g a n d de c o m p a c t i n g a s i g n i f i c a n t l y i m p a c t e d s i t e : F o r b o t h t y p e s o f i m p l e m e n t , h a v e a t l e a s t 4 0 h p o f tr a c t o r p u l l a v a i l a b l e f o r e a c h m o u n t e d s h a n k / l e g . Us i n g t h e e x a m p l e s o f a 3 - s h a n k a n d a 5 - s h a n k i m p l e m e n t , t h e r e s p e c t i v e t r a c t o r s s h o u l d h a v e 1 2 0 an d 2 0 0 h p a v a i l a b l e f o r f r a c t u r i n g d o w n t o t h e f i n a l d e p t h o f 2 0 - t o - 2 4 i n c h e s p e r p h a s e . F i n a l de p t h f o r t h e d e e p r i p p i n g i n P h a s e 1 i s a c h i e v e d i n c r e m e n t a l l y b y a p r o g r e s s i v e s e r i e s o f p a s s e s (s e e D e p t h a n d P a t t e r n s o f M o v e m e n t , b e l o w ) ; w h i l e f o r P h a s e 2 , t h e f u l l o p e r a t i n g d e p t h o f t h e de e p s u b s o i l e r i s a p p l i e d f r o m t h e b e g i n n i n g . Th e o p e r a t i n g s p e e d f o r p u l l i n g b o t h t y p e s o f im p l e m e n t s h o u l d n o t e x c e e d 2 t o 3 m p h . A t th i s s l o w a n d m a n a g e d r a t e o f o p e r a t i n g s p e e d , ma x i m u m f u n c t i o n a l p e r f o r m a n c e i s s u s t a i n e d by t h e t r a c t o r a n d t h e i m p l e m e n t p e r f o r m i n g t h e so i l f r a c t u r i n g . R e f e r r i n g t o F i g u r e 8 , t h e im p l e m e n t i s t h e 6 - l e g v e r s i o n o f t h e d e e p an g l e d - l e g s u b s o i l e r . I t s t w o o u t s i d e l e g s a r e “c h a i n e d u p ” s o t h a t o n l y f o u r l e g s w i l l b e en g a g e d ( a t t h e m a x i m u m d e p t h ) , r e q u i r i n g n o le s s t h a n 1 6 0 h p , ( r a t h e r t h a n 2 4 0 h p ) o f p u l l . Th e 4 - w h e e l d r i v e , a r t i c u l a t e d - f r a m e t r a c t o r i n Fi g u r e 8 i s 1 7 4 h p . I t w i l l b e d e c o m p a c t i n g t h i s un o b s t r u c t e d , f o r m e r c o n s t r u c t i o n a c c e s s a r e a si m u l t a n e o u s l y t h r o u g h 1 1 i n c h e s o f r e p l a c e d to p s o i l a n d t h e u p p e r 1 2 i n c h e s o f t h e pr e v i o u s l y d e e p - r i p p e d s u b s o i l . I n c o n s t r i c t e d ar e a s o f P h a s e 1 ) D e e p R i p p i n g , a m e d i u m - s i z e tr a c t o r w i t h a d e q u a t e h p , s u c h a s t h e o n e i n Fi g u r e 9 p u l l i n g a 3 - s h a n k d e e p r i p p e r , m a y b e mo r e m a n e u v e r a b l e . So m e i n d u s t r i a l - g r a d e v a r i a t i o n s o f r i p p i n g im p l e m e n t s a r e a t t a c h e d t o p o w e r g r a d e r s a n d bu l l d o z e r s . A l t h o u g h h i g h l y d u r a b l e , t h e y a r e ge n e r a l l y n o t r e c o m m e n d e d . T y p i c a l l y , t h e sh a n k s o r “ t e e t h ” o f t h e s e r i p p e r s a r e t o o s h o r t an d s t o u t ; a n d t h e y a r e m o u n t e d t o o f a r a p a r t t o ac h i e v e t h e w e l l - d i s t r i b u t e d t y p e o f l a t e r a l a n d ve r t i c a l f r a c t u r i n g o f t h e s o i l m a t e r i a l s ne c e s s a r y t o r e s t o r e s o i l p e r m e a b i l i t y a n d in f i l t r a t i o n . I n a d d i t i o n , t h e p o w e r g r a d e r s a n d bu l l d o z e r s , a s p u l l e r s , a r e f a r l e s s m a n e u v e r a b l e fo r t u r n s a n d p a t t e r n s t h a n t h e t r a c t o r . Fi g . 9 . T h i s m e d i u m t r a c t o r i s p u l l i n g a 3 - sh a n k d e e p r i p p e r . T h e s e v e r e l y c o m p a c t e d co n s t r u c t i o n a c c e s s c o r r i d o r i s n a r r o w , a n d t h e 12 0 h p t r a c t o r i s m o r e m a n e u v e r a b l e f o r P h a s e 1 d e e p r i p p i n g ( s u b s o i l f r a c t u r i n g ) , h e r e . 8 De p t h a n d P a t t e r n s o f M o v e m e n t As p r e v i o u s l y n o t e d b o t h P h a s e 1 D e e p R i p p i n g t h r o u g h s i g n i f i c a n t l y c o m p r e s s e d , e x p o s e d s u b s o i l an d P h a s e 2 D e c o m p a c t i o n ( d e e p s u b s o i l i n g ) t h r o u g h t h e r e p l a c e d t o p s o i l a n d u p p e r s u b s o i l n e e d to b e p e r f o r m e d a t m a x i m u m c a p a b l e d e p t h o f e a c h i m p l e m e n t . W i t h a n i m p l e m e n t ’ s g u i d e w h e e l s at t a c h e d , s o m e h a v e a “ n o r m a l ” m a x i m u m o p e r a t i n g d e p t h o f 1 8 i n c h e s , w h i l e o t h e r s m a y g o de e p e r . I n m a n y s i t u a t i o n s , h o w e v e r , t h e t r a c t o r / i m p l e m e n t o p e r a t o r m u s t f i r s t r e m o v e t h e g u i d e wh e e l s a n d o t h e r n o n e s s e n t i a l e l e m e n t s f r o m t h e i m p l e m e n t . T h i s a d a p t s t h e r i p p e r o r t h e d e e p su b s o i l e r f o r s k i l l f u l p u l l i n g w i t h i t s f r a m e o n l y a f e w i n c h e s a b o v e s u r f a c e , w h i l e t h e s h a n k s o r le g s , f r a c t u r e t h e s o i l m a t e r i a l 2 0 - t o - 2 4 i n c h e s d e e p . Th e r e m a y b e c o n s t r u c t i o n s i t e s w h e r e t h e d e p t h o f t h e e x p o s e d s u b s o i l ’ s c o m p r e s s i o n i s m o d e r a t e , e. g . : 1 2 i n c h e s , r a t h e r t h a n d e e p . T h i s c a n b e v e r i f i e d b y u s i n g a ¾ i n c h c o n e p e n e t r o m e t e r a n d a sh o v e l t o t e s t t h e s u b s o i l f o r i t s l e v e l o f c o m p a c t i o n , i n c r e m e n t a l l y , e v e r y t h r e e i n c h e s o f in c r e a s i n g d e p t h . O n c e t h e f u l l t h i c k n e s s o f t h e s u b s o i l ’ s c o m p a c t e d z o n e i s f i n a l l y “ p i e c e d ” a n d th e r e i s a s i g n i f i c a n t d r o p i n t h e p s i m e a s u r e m e n t s o f t h e s o i l p e n e t r o m e t e r , t h e d e p t h / t h i c k n e s s o f co m p a c t i o n i s d e t e r m i n e d . T h i s i s r e p e a t e d a t s e v e r a l r e p r e s e n t a t i v e l o c a t i o n s o f t h e c o n s t r u c t i o n si t e . I f t h e t h i c k n e s s o f t h e s i t e ’ s s u b s o i l c o m p a c ti o n i s v e r i f i e d a s , f o r e x a m p l e , t e n i n c h e s , t h e n th e P h a s e 1 D e e p R i p p i n g c a n b e c o r r e s p o n d i n g l y r e d u c e d t o t h e i m p l e m e n t ’ s m i n i m u m o p e r a b l e de p t h o f 1 2 i n c h e s . H o w e v e r , t h e P h a s e 2 s i m u l t a n e o u s D e c o m p a t i o n ( s u b s o i l i n g ) o f a n 1 1 i n c h th i c k l a y e r o f r e p l a c e d t o p s o i l a n d t h e u p p e r s u b s o i l s h o u l d r u n a t t h e s u b s o i l i n g i m p l e m e n t s f u l l op e r a t i n g d e p t h . Ty p i c a l l y , t h r e e s e p a r a t e s e r i e s ( p a t t e r n s ) a r e u s e d f o r b o t h t h e P h a s e 1 D e e p R i p p i n g a n d t h e Ph a s e 2 D e c o m p a c t i o n o n s i g n i f i c a n t l y c o m p a c t e d s i t e s . F o r P h a s e 1 , e a c h s e r i e s b e g i n s w i t h a mo d e r a t e d e p t h o f r i p a n d , b y r e p e a t - p a s s , c o n t i n u e s u n t i l f u l l d e p t h i s r e a c h e d . P h a s e 2 a p p l i e s t h e fu l l d e p t h o f D e c o m p a t i o n ( s u b s o i l i n g ) , f r o m t h e b e g i n n i n g . Ev e r y s e p a r a t e s e r i e s ( p a t t e r n ) c o n s i s t s o f p a r a l l e l , f o r w a r d - a n d - r e t u r n r u n s , w i t h e a c h p r o g r e s s i v e Fi g . 1 1 . A r e p e a t r u n o f t h e 3 - s h a n k r i p p e r al o n g t h e s a m e p a t t e r n e d p a s s a r e a a s F i g . 9 ; he r e , i n c r e m e n t a l l y r e a c h i n g 1 8 o f t h e n e e d e d 22 i n c h e s o f s u b s o i l f r a c t u r e . Fi g . 1 0 . A n e a r l y p a s s w i t h a 3 - s h a n k d e e p ri p p e r p e n e t r a t i n g o n l y 8 i n c h e s i n t o t h i s wo r k s i t e ’ s s e v e r e l y c o m p r e s s e d s u b s o i l . 9 pa s s o f t h e i m p l e m e n t ’ s l e g s o r s h a n k s e v e n l y s t a g g e r e d b e t w e e n t h o s e f r o m t h e p r e v i o u s p a s s . Th i s c o m p e n s a t e s f o r t h e s h a n k o r l e g - s p a c i n g o n t h e i m p l e m e n t , e . g . , w i t h 2 4 - t o - 3 0 i n c h e s be t w e e n e a c h s h a n k o r l e g . T h e s t a g g e r e d r e t u r n p a s s e n s u r e s l a t e r a l a n d v e r t i c a l f r a c t u r i n g ac t u a t e d e v e r y 1 2 t o 1 5 i n c h e s a c r o s s t h e d e n s e l y c o m p r e s s e d s o i l m a s s . La r g e , U n o b s t r u c t e d A r e a s Fo r l a r g e r e a s y a r e a s , u s e t h e s t a n d a r d p a t t e r n s o f m o v e m e n t : Ɣ T h e f i r s t s e r i e s ( p a t t e r n ) o f p a s s e s i s a p p l i e d l e n g t h w i s e , p a r a l l e l w i t h t h e l o n g e s t sp r e a d o f t h e s i t e ; g r a d u a l l y p r o g r e s s i n g a c r o s s t h e s i t e ’ s w i d t h , w i t h e a c h su c c e s s i v e p a s s . Ɣ T h e s e c o n d s e r i e s r u n s o b l i q u e l y , c r o s s i n g t h e f i r s t s e r i e s a t a n a n g l e o f ab o u t 4 5 d e g r e e s . Ɣ T h e t h i r d s e r i e s r u n s a t r i g h t a n g l e ( o r 9 0 d e g r e e s ) , t o t h e f i r s t s e r i e s t o c o m p l e t e th e f r a c t u r i n g a n d s h a t t e r i n g o n s e v e r e l y c o m p a c t e d s i t e s , a n d a v o i d l e a v i n g l a r g e un b r o k e n b l o c k s o f c o m p r e s s e d s o i l m a t e r i a l . ( I n c e r t a i n i n s t a n c e s , t h e t h i r d s e r i e s ma y b e o p t i o n a l , d e p e n d i n g o n h o w t h o r o u g h l y t h e f i r s t t w o s e r i e s l o o s e n t h e ma t e r i a l a n d e l i m i n a t e l a r g e c h u n k s / b l o c k s o f m a t e r i a l a s v e r i f i e d b y t e s t s w i t h a ¾ - in c h c o n e p e n e t r o m e t e r . ) Co r r i d o r s In l o n g c o r r i d o r s o f l i m i t e d w i d t h a n d l e s s m a n e u v e r a b i l i t y t h a n l a r g e r s i t e s , e . g . : a l o n g co m p a c t e d a r e a s u s e d a s t e m p o r a r y c o n s t r u c t i o n a c c e s s , a m o d i f i e d s e r i e s o f p a t t e r n p a s s e s ar e u s e d . Ɣ F i r s t , a p p l y t h e s a m e i n i t i a l l e n g t h w i s e , p a r a l l e l s e r i e s o f p a s s e s d e s c r i b e d a b o v e . Fi g . 1 2 . M o d e r a t e l y d r y t o p s o i l i s b e i n g re p l a c e d o n t h e a f f e c t e d s i t e n o w t h a t P h a s e 1 de e p r i p p i n g o f t h e c o m p r e s s e d s u b s o i l i s co m p l e t e . Fi g . 1 3 . T h e s a m e d e e p , a n g l e d - l e g s u b s o i l e r sh o w n i n F i g . 7 i s e n g a g e d a t m a x i m u m de p t h f o r P h a s e 2 , d e c o m p a c t i o n ( d e e p so i l i n g ) , o f t h e r e p l a c e d t o p s o i l a n d t h e u p p e r su b s o i l m a t e r i a l s . 10 Fi g . 1 5 . T h e s a m e s i t e a s F i g . 1 4 a f t e r d e e p ri p p i n g o f t h e e x p o s e d s u b s o i l , t o p s o i l re p l a c e m e n t , d e c o m p a c t i o n t h r o u g h t h e to p s o i l a n d u p p e r s u b s o i l a n d f i n a l s u r f a c e ti l l a g e a n d r e v e g e t a t i o n t o m a i n t a i n s o i l pe r m e a b i l i t y a n d i n f i l t r a t i o n . Ɣ A s e c o n d s e r i e s o f p a s s e s m a k e s a b r o a d “ S ” s h a p e d p a t t e r n o f r i p s , c o n t i n u a l l y an d g r a d u a l l y a l t e r n a t i n g t h e “ S ” c u r v e s b e t w e e n o p p o s i t e e d g e s i n s i d e t h e co m p a c t e d c o r r i d o r . Ɣ T h e t h i r d a n d f i n a l s e r i e s a g a i n u s e s t h e b r o a d , a l t e r n a t i n g S p a t t e r n , b u t i t i s “f l i p - f l o p p e d ” t o c o n t i n u a l l y c r o s s t h e p r e v i o u s S p a t t e r n a l o n g t h e c o r r i d o r ’ s ce n t e r l i n e . T h i s f i n a l s e r i e s o f t h e S p a t t e r n c u r v e s b a c k a l o n g t h e e d g e a r e a s sk i p p e d b y t h e s e c o n d s e r i e s . Ma i n t e n a n c e a n d C o s t On c e t h e t w o - p h a s e p r a c t i c e o f D e e p R i p p i n g a n d D e c o m p a t i o n i s c o m p l e t e d , t w o i t e m s a r e es s e n t i a l f o r m a i n t a i n i n g a s i t e ’ s s o i l p o r o s i t y a n d p e r m e a b i l i t y f o r i n f i l t r a t i o n . T h e y a r e : p l a n t i n g an d m a i n t a i n i n g t h e a p p r o p r i a t e g r o u n d c o v e r w i t h d e e p r o o t s t o m a i n t a i n t h e s o i l s t r u c t u r e ( s e e Fi g u r e 1 5 ) ; a n d k e e p i n g t h e s i t e f r e e o f t r a f f i c o r o t h e r w e i g h t l o a d s . No t e t h a t s i t e - s p e c i f i c c h o i c e o f a n a p p r o p r i a t e v e g e t a t i v e g r o u n d - c o v e r s e e d m i x , i n c l u d i n g t h e pr o p e r s e e d i n g r a t i o o f o n e o r m o r e p e r e n n i a l s p e c i e s w i t h a d e e p t a p r o o t s y s t e m a n d t h e p r o p e r am o u n t o f l i m e a n d s o i l n u t r i e n t s ( f e r t i l i z e r m i x ) a d a p t e d t o t h e s o i l - n e e d s , a r e b a s i c t o t h e f i n a l pr a c t i c e o f l a n d s c a p i n g , i . e : s u r f a c e t i l l a g e , s e e d i n g / p l a n t i n g / f e r t i l i z i n g a n d c u l t i - p a c k i n g o r mu l c h i n g i s a p p l i e d . T h e " m a i n t e n a n c e " o f a n e f f e c t i v e l y d e e p - r i p p e d a n d d e c o m p a c t e d a r e a i s ge n e r a l l y l i m i t e d t o t h e s u c c e s s f u l p e r e n n i a l ( l o n g - t e r m ) l a n d s c a p e g r o u n d c o v e r ; a s l o n g a s n o we i g h t - b e a r i n g f o r c e o f s o i l c o m p a c t i o n i s a p p l i e d . Fi g . 1 4 . T h e s e v e r e l y c o m p a c t e d s o i l o f a te m p o r a r y c o n s t r u c t i o n y a r d u s e d d a i l y b y he a v y e q u i p m e n t f o r f o u r m o n t h s ; s h o w n be f o r e d e e p r i p p i n g , t o p s o i l r e p l a c e m e n t , a n d de c o m p a c t i o n . 11 Th e D e e p R i p p i n g a n d D e c o m p a c t i o n p r a c t i c e i s , b y n e c e s s i t y , m o r e e x t e n s i v e t h a n p e r i o d i c su b s o i l i n g o f f a r m l a n d . T h e c o s t o f d e e p r i p p i n g a n d d e c o m p a c t i n g ( d e e p s u b s o i l i n g ) , w i l l v a r y ac c o r d i n g t o t h e d e p t h a n d s e v e r i t y o f s o i l - m a t e r i a l c o m p r e s s i o n a n d t h e r e l a t i v e a m o u n t o f tr a c t o r a n d i m p l e m e n t t i m e t h a t i s r e q u i r e d . I n s o m e i n s t a n c e s , d e p e n d i n g o n o p e n ma n e u v e r a b i l i t y , t w o - t o - t h r e e a c r e s o f c o m p a c t e d p r o j e c t a r e a m a y b e d e e p - r i p p e d i n o n e d a y . I n ot h e r s i t u a t i o n s o f m o r e s e v e r e c o m p a c t i o n a n d - o r l e s s m a n e u v e r a b i l i t y , a s l i t t l e a s o n e a c r e m a y be f u l l y r i p p e d i n a d a y . G e n e r a l l y , i f t h e P h a s e 1 ) D e e p R i p p i n g i s f u l l y e f f e c t i v e , t h e P h a s e 2 ) De c o m p a c t i o n s h o u l d b e c o m p l e t e d i n 2 / 3 t o 3 / 4 o f t h e t i m e r e q u i r e d f o r P h a s e 1 . Us i n g t h e e x a m p l e o f t w o a c r e s o f P h a s e 1 ) D e e p R i p p i n g i n o n e d a y , a t $ 1 8 0 0 p e r d a y , t h e n e t co s t i s $ 9 0 0 p e r a c r e . I f t h e P h a s e 2 ) D e c o m p a c t i n g o r d e e p s u b s o i l i n g t a k e s 3 / 4 t h e t i m e a s P h a s e 1, i t c o s t s $ 6 7 5 p e r a c r e f o r a c o m b i n e d t o t a l o f $ 1 5 7 5 p e r a c r e t o c o m p l e t e t h e p r a c t i c e ( t h e s e fi g u r e s d o n o t i n c l u d e t h e c o s t o f t h e s e p a r a t e p r a c t i c e o f t o p s o i l s t r i p p i n g a n d r e p l a c e m e n t ) . D u e to t h e m a n y v a r i a b l e s , i t m u s t b e r e c o g n i z e d t h a t c o s t w i l l b e d e t e r m i n e d b y t h e s p e c i f i c c o n d i t i o n s or c o n s t r a i n t s o f t h e s i t e a n d t h e a v a i l a b i l i t y o f p r o p e r e q u i p m e n t . 12 Re s o u r c e s Pu b l i c a t i o n s :ȱ ȣȱ Am e r i c a n ȱȱ So c i e t y ȱof ȱȱ Ag r i c u l t u r a l ȱEn g i n e e r s . ȱ19 7 1 . ȱȱCo m p a c t i o n ȱof ȱȱ Ag r i c u l t u r a l ȱȱ So i l s . ȱȱ AS A E . ȱ ȱȣȱ Br a d y , ȱN. C . , ȱan d ȱR. R . ȱWe i l . ȱ20 0 2 . ȱȱ Th e ȱȱ Na t u r e ȱȱ an d ȱȱ Pr o p e r t i e s ȱȱ of ȱȱ So i l s . ȱ13 th ȱed . ȱPe a r s o n ȱEd u c a t i o n , ȱIn c . ȱ ȱȣȱ Ba v e r , ȱL. D . ȱ19 4 8 . ȱSo i l ȱPh y s i c s . ȱJo h n ȱWi l e y ȱ&ȱSo n s . ȱ ȱȣȱ Ca r p a c h i , ȱN. ȱ 19 8 7 ȱ (1 9 9 5 ȱ fi f t h ȱ pr i n t i n g ) . ȱEx c a v a t i o n ȱ an d ȱ Gr a d i n g ȱ Ha n d b o o k , ȱ Re v i s e d . ȱȱ 2nd ȱed . ȱ Cr a f t s m a n ȱ Bo o k ȱ Co m p a n y ȱ ȣȱ El l i s , ȱB. ȱ(E d i t o r ) . ȱ19 9 7 . ȱȱ Sa f e ȱ&ȱEa s y ȱLa w n ȱCa r e : ȱȱ Th e ȱCo m p l e t e ȱGu i d e ȱto ȱOr g a n i c ȱLo w ȱMa i n t e n a n c e ȱLa w n . ȱȱ Ho u g h t o n ȱMi f f l i n . ȱ ȱȣȱ Ha r p s t e a d , ȱ M. I . , ȱ T. J . ȱ Sa u e r , ȱ an d ȱ W. F . ȱ Be n n e t t . ȱ 20 0 1 . ȱȱ So i l ȱ Sc i e n c e ȱ Si m p l i f i e d . ȱ 4th ȱ ed . ȱ Io w a ȱ St a t e ȱ Un i v e r s i t y ȱȱ Pr e s s . ȱ ȱȣȱ ȱ Ma g d o f f , ȱ F. , ȱȱ an d ȱȱ H. ȱ va n ȱ Es . ȱȱ 20 0 0 . ȱȱ Bu i l d i n g ȱ So i l s ȱȱ fo r ȱȱ Be t t e r ȱ Cr o p s . ȱ 2nd ȱ ed . ȱ Su s t a i n a b l e ȱ Ag r i c u l t u r a l ȱ Ne t w o r k s ȱ ȱȣȱ ȱ Mc C a r t h y , ȱD. F . ȱ19 9 3 . ȱEs s e n t i a l s ȱof ȱSo i l ȱMe c h a n i c s ȱan d ȱFo u n d a t i o n s , ȱBa s i c ȱGe o t e c h n i c s ȱ4th ȱed . ȱRe g e n t s / P r e n t i c e ȱ Ha l l . ȱ ȱȣȱ ȱ ȱ ȱ ȱ ȱ Pl a s t e r , ȱE. J . ȱ19 9 2 . ȱSo i l ȱSc i e n c e ȱ&ȱMa n a g e m e n t . ȱ3rd ȱed . ȱDe l m a r ȱPu b l i s h e r s . ȱ ȱȣȱ ȱ ȱ Un i o n ȱ Ga s ȱ Li m i t e d , ȱ On t a r i o , ȱ Ca n a d a . ȱ 19 8 4 . ȱ Re h a b i l i t a t i o n ȱ of ȱ Ag r i c u l t u r a l ȱ La n d s , ȱ Da w n ȬKe r w o o d ȱȱ Lo o p ȱȱ Pi p e l i n e ; ȱȱ ȱ Te c h n i c a l ȱȱ ȱ Re p o r t .ȱȱ ȱ Ec o l o g i c a l ȱȱ ȱ Se r v i c e s ȱȱ fo r ȱȱ Pl a n n i n g , ȱȱ Lt d . ; ȱ Ro b i n s o n , ȱ Me r r i t t ȱ &ȱDe v r i e s , ȱ Lt d . ȱan d ȱSm i t h , ȱHo f f m a n ȱAs s o c i a t e s , ȱLt d . ȱ ȱȣȱ ȱ ȱ US ȱDe p a r t m e n t ȱof ȱAg r i c u l t u r e ȱin ȱco o p e r a t i o n ȱwi t h ȱCo r n e l l ȱUn i v e r s i t y ȱAg r i c u l t u r a l ȱEx p e r i m e n t ȱȱ St a t i o n . ȱȱ Va r i o u s ȱye a r s . ȱȱSo i l ȱȱ Su r v e y ȱof ȱȱ (v a r i o u s ȱna m e s ) ȱȱCo u n t y , ȱȱ Ne w ȱYo r k . ȱUS D A . ȱ ȱIn t e r n e t ȱAc c e s s : ȱ ȣȱ ȱ ȱ ȱ Ex a m p l e s ȱof ȱim p l e m e n t s : ȱȱ ȱVȬRi p p e r s . ȱȱ Ac c e s s ȱby ȱȱ in t e r n e t ȱse a r c h ȱof ȱJo h n ȱDe e r e ȱAg ȱȬ Ne w ȱEq u i p m e n t ȱȱ ȱ fo r ȱȱ 91 5 ȱȱ(l a r g e r Ȭfr a m e ȱmo d e l ) ȱȱVȬ Ri p p e ;ȱȱ an d , ȱȱ ȱ fo r ȱ91 3 ȱȱ (s m a l l e r Ȭfr a m e ȱmo d e l ) ȱVȬRi p p e r .ȱȱ De e p , ȱan g l e d Ȭle g ȱsu b s o i l e r . ȱȱ Ac c e s s ȱȱ by ȱȱ in t e r n e t ȱ se a r c h ȱȱ of : ȱBig h a m ȱȱ Br o t h e r s ȱSh e a r ȱBo l t ȱȱ Pa r a t i l l ȬSu b s o i l e r . ȱ ht t p : / / s a l e s m a n u a l . d e e r e . c o m / s a l e s / s a l e sm a n u a l / e n _ N A / p r i m a r y _ t i l l a g e / 2 0 0 8 / f e a t u r e/ r i p p e r s / 9 1 5 v _ p a t t e r n _ f r a m e . h t m l ? s b u = a g& l i n k = p r o d c a t La s t ȱvi s i t e d ȱMa r c h ȱ08 . ȱ ȱȣȱ So i l s ȱ da t a ȱ of ȱ US D A ȱ Na t u r a l ȱ Re s o u r c e s ȱ Co n s e r v a t i o n ȱ Se r v i c e . ȱ NR C S ȱ We b ȱ So i l ȱ Su r v e y . ȱȱ ȱ ȱ ȱ ȱ ȱ ȱ ȱ ȱ ȱ ȱ ȱ ȱ ht t p : / / w e b s o i l s u r v e y . n r c s . u s d a . g o v / a p p / ȱȱ ȱ an d ȱȱUS D A ȬNR C S ȱȱ Of f i c i a l ȱȱ So i l ȱȱ Se r i e s ȱDe s c r i p t i o n s ; ȱ Vi e w ȱby ȱ Na m e . ȱht t p : / / o r t h o . f t w . n r c s . u s d a . g o v / c g i Ȭbi n / o s d / o s d n a m e . c g i ȱ.ȱLa s t ȱvi s i t e d ȱJa n . ȱ08 . ȱ ȱȣȱ ȱ So i l ȱȱ pe n e t r o m e t e r ȱȱ in f o r m a t i o n . ȱȱ Ac c e s s ȱȱ by ȱȱ ȱ in t e r n e t ȱȱ se a r c h e s ȱȱ of : ȱȱ ȱ Di a g n o s i n g ȱSo i l ȱCo m p a c t i o n ȱȱ ȱ us i n g ȱȱ aȱ Pe n e t r o m e t e r ȱ(s o i l ȱco m p a c t i o n ȱte s t e r ) , ȱPS U ȱEx t e n s i o n ; ȱȱ as ȱȱ we l l ȱȱ as ȱDi c k e y Ȭjo h n ȱSo i l ȱCo m p a c t i o n ȱTe s t e r .ȱ ht t p : / / w w w . d i c k e y - j o h n p r o d u c t s . c o m / p d f / S o i l C o m p a c t i o n T e s t . p d f a n d ht t p : / / c r o p s o i l . p s u . e d u / E x t e n s i o n / F a c t s / u c 1 7 8 p d f La s t ȱ vi s i t e d ȱSe p t . ȱ07 ȱ