The URL can be used to link to this page

Home My WebLink About20240049 282 Ballston Egress Windows ApplicationRevised 01/2021 APPLICATION FOR: ARCHITECTURAL / HISTORIC REVIEW APPLICANT(S)* OWNER(S) (If not applicant) ATTORNEY/AGENT Name Address Phone / / / Email Identify primary contact person:  Applicant Owner Attorney/Agent * An applicant must be the property owner, lessee, or one with an option to lease or purchase the property in question. Applicant’s interest in premises: Owner Lessee Under option to lease or purchase PROPERTY INFORMATION Property Address/Location: Tax Parcel #: . - - (for example: 165.52 – 4 – 37 ) Current Zoning District: Property use:  Residential Non-residential/mixed-use Type of Review:  Architectural Historic Extension/modification (of current approval) Summary description of proposed action: Has a previous application been filed with the DRC for this property? No  Yes – date(s)? _____________________ -App. No.(s)? _________________ Date Acquired by Owner: _________________ **HANDWRITTEN APPLICATIONS WILL NOT BE ACCEPTED** CITY OF SARATOGA SPRINGS DESIGN REVIEW COMMISSION CITY HALL - 474 BROADWAY SARATOGA SPRINGS, NEW YORK 12866-2296 TEL: 518-587-3550 X2533 www.saratoga-springs.org [FOR OFFICE USE] _______________ (Application #) ____________ (Date received) __________________________ (Project Title) Staff Review _______________ **A “complete” application consists of 1 hard copy (original) , and 1 electronic copy of application & ALL other materials as required below: New Construction / Additions Color photographs showing site/exterior details of existing structures and adjacent properties Site plan, drawn to scale, showing existing & proposed construction, property lines & dimensions, required & proposed setbacks & lot coverage, site features (fences, walks, trees, etc.); on no larger than 2’x3’ sheet – smaller preferred if legible Elevation drawings showing design of all sides of existing & proposed construction – label dimensions, colors, materials, lighting (fixture & lamp type, wattage), etc. - include compass bearing & scale; no larger than 2’x3’ sheet – smaller permitted if legible Floor plans for proposed structure; on sheet no larger than 2’x3’ – smaller permitted if legible Product literature, specifications and samples of proposed materials and colors Change in exterior building materials (windows, doors, roof, siding, etc.), or color (in non-residential districts only) Color photographs showing site/exterior details of existing structures and that illustrate affected features Elevation drawings showing all sides of existing & proposed construction – label dimensions, colors, materials, lighting (fixture & lamp type, wattage), etc. - include compass bearing & scale; no larger than 2’x3’ sheet – smaller permitted if legible Product literature, specifications and samples of proposed materials and colors Within front yard setbacks in Historic Districts only (Front setbacks: UR-1 & INST-HTR=30’; UR-4=25’; UR-2, UR-3 & NCUD-1=10’) -Installation, removal or change in material of drive- and walkways -Installation or removal of architectural, sculptural or vegetative screening over 3’ in height -Installation of accessory utility structures or radio/satellite transmission/reception devices (more than 2’ diameter) For any of above: Color photographs showing site/exterior details of existing structures, and of adjacent properties Site plan showing existing & proposed construction: include property lines & dimensions, required & proposed setbacks & lot coverage, site features (fences, walks, trees, etc.) street names, compass bearing & scale; no larger than 2’x3’ sheet – smaller preferred if legible Product literature, specifications and samples of proposed materials and colors Signage / Awnings Color photographs showing site/exterior details of existing structures, and adjacent properties Plan showing location of proposed sign/awning structure on building/premises: no larger than 11”x17” Scaled illustration of proposed sign/awning structure and lettering (front view & profile): include all dimensions of structure; type, dimensions and style of lettering or logo; description of colors, materials, mounting method and hardware Descriptions, specifications of proposed lighting including fixture & lamp type, wattage, mounting method, and location Product literature, specifications and samples of proposed materials and colors Demolition Color photographs showing site/exterior details of existing structures, and of adjacent properties Site plan showing existing and any proposed structures - include dimensions, setbacks, street names, compass bearing, and scale Written description of reasons for demolition and, in addition: For structures of “architectural/historical significance”, demonstrate “good cause” why structure cannot be preserved For structures in an architectural district that might be eligible for listing on National Register of Historic Places, or for a “contributing” structure in a National Register district (contact City staff), provide plans for site development following demolition - include a timetable and letter of credit for project completion Telecommunication facilities Color photographs showing site/existing structures, and of adjacent properties Site plan showing existing and proposed structures: include dimensions, setbacks, street names, compass bearing, and scale Scaled illustration of proposed structures: include all dimensions; colors, materials, lighting, mounting details Consult Article 240-12.22 of the City’s Zoning Ordinance and City staff to ensure compliance with requirements for visual impact assessment and existing and proposed vegetative screening Revised 01/2021 Revised 01/2021 Request for extension of current approval Identify date of original DRC approval: ______________Current expiration date: ________________ Org. App. No. ____________ Describe why this extension is necessary and whether any significant changes have occurred either on the site or in the neighborhood. SEQR Environmental Assessment Form Applicants proposing the following must complete “Part I” of the SEQR Short Environmental Assessment Form (available here: http://www.dec.ny.gov/docs/permits_ej_operations_pdf/seafpartone.pdf): -Construction or expansion of a multi-family residential structure (4 units +) -Construction or expansion (exceeding 4,000 sq. ft. gross floor area) of a principal or accessory non-residential structure -Telecommunications facility, radio antennae, satellite dishes -Demolition Disclosure Does any City officer, employee or family member thereof have a financial interest (as defined by General Municipal Law Section 809) in this application? No  Yes - If yes, a statement disclosing the name, residence, nature, and extent of this interest must be filed with this application. Certification I/we, the property owner(s), or purchaser(s)/lessee(s) under contract, of the land in question, hereby request an appearance before the Design Review Commission. By the signature(s) attached hereto, I/we certify that the information provided within this application and accompanying documentation is, to the best of my/our knowledge, true and accurate. I/we further understand that intentionally providing false or misleading information is grounds for immediate denial of this application. I/we hereby authorize the members of the Design Review Commission and designated City staff to enter the property associated with this application for purposes of conducting any necessary site inspections relating to this application. Furthermore, I/we agree to meet all requirements under Article VII for Historic Review or Article VIII for Architectural Review of the Zoning Code of the City of Saratoga Springs. Date: (applicant signature) Date: (applicant signature) If applicant is not the currently the owner of the property, the current owner must also sign. Owner Signature: Date: Owner Signature: Date: Revised 01/2021 INSTRUCTIONS ARCHITECTURAL / HISTORIC REVIEW APPLICATION 1.ELIGIBILITY: An applicant to the Design Review Commission for Architectural Review or Historic Review must be the property owner(s) or lessee, or have an option to lease or purchase the property in question. 2.COMPLETE SUBMISSIONS: Applicants are encouraged to work with City staff to ensure that an application is complete. The DRC will only consider properly completed applications that contain 1 original and 1 digital version of the application and ALL other required materials as indicated on the application. HANDWRITTEN APPLICATIONS WILL NOT BE ACCEPTED!! 3.ACTIONS REQUIRING REVIEW: Architectural Review District Historic Review District •any exterior changes that require a building permit •any change in exterior building materials •a new, or change to an existing, sign or sign structure •demolition of a structure Within a non-residential zoning district: •a change in exterior building color •installation of an awning •Installation or exterior change to a structure requiring a building or demolition permit •any material change to exterior of a structure including: -addition or removal of exterior architectural features -installation, removal or material changes to exterior building elements such as roof, siding, windows, doors, porches, etc. -enclosure or screening or buildings openings such as windows, doors, porches, etc. -installation of utility, mechanical or misc. accessory structures to the exterior of a building such as HVAC equipment, solar panels, wind turbines, radio/satellite transmission/reception devices, etc. Within a front yard setback: -installation, removal or material changes to drive- or walkways -installation or removal of architectural, sculptural or vegetative screening that exceeds 3’ in height -installation of accessory utility structures or radio/satellite transmission/reception devices over 2’ in diameter •a change in exterior building color within a non- residential zoning district •a new, or change to an existing, sign or awning •installation of telecommunications facilities Note – Ordinary maintenance or repair that does not involve a change in material, design or outer appearance is exempt from Historic or Architectural Review. CITY OF SARATOGA SPRINGS DESIGN REVIEW COMMISSION City Hall - 474 Broadway Saratoga Springs, New York 12866 Tel: 518-587-3550 x2533 www.saratoga-springs.org 4.DESIGN GUIDELINES: The Design Review Commission will evaluate whether the proposed action (construction, alteration or demolition) is compatible with existing structures and surrounding properties using the following criteria: •Height – consistent with historic form and context of site and surrounding properties •Scale – relationship of structure and its architectural elements to human size, form, perception •Proportion – relationship among building elements including front façade, windows, and doors •Rhythm – pattern resulting from repeating building elements such as door/window openings, columns, arches, and other façade elements •Directional Expression – compatibility with horizontal & vertical expression of surrounding structures •Massing & Open Space – relationship of structure to open space between it and adjoining buildings •Setback – compatibility with surrounding structures •Compatibility of the following with surrounding structures/properties: -Major building elements (storefronts, doors, windows, roof) -Building materials -Color – (in non-residential zoning districts only) 5.DECISIONS: The Design Review Commission may approve, approve with conditions, or disapprove an application. The DRC may impose appropriate conditions and safeguards in connection with its approval including nature/quality of materials, manner of construction, and design. An applicant may appeal a denied DRC application on the grounds of hardship. Application approvals shall expire within 18 months of the filing date unless the project has sufficiently commenced (i.e. building/demolition permits obtained and construction/alteration begun). Applicants may request up to 2 extensions if requested before expiration date of prior approval. 6.AGENDA DATE: Check City’s website (www.saratoga-springs.org) for meeting dates. Applications are placed on an agenda on first-come, first-served basis as determined by the completeness of the application. 7.APPLICATION FEE (NON-REFUNDABLE): Make checks payable to the "Commissioner of Finance”. REFER TO THE CURRENT FEE WORKSHEET INCLUDED IN THIS DOCUMENT. ADDITIONAL INFORMATION: More detailed information on Architectural Review, Historic Review and the Design Review Commission responsibilities may be found in the City’s Zoning Ordinance available in City Hall and on the City’s web site at http://www.saratoga-springs.org/544/Zoning-Ordinance. Revised 01/2021 Application to City Council FEE Comprehensive Plan amendment $1,800 + $300/acre Zoning Ordinance amendment $800 + $300/acre Planned Unit Development (PUD) amendment $800 + $300/acre Application to Zoning Board of Appeals Use Variance $1,400 + $50/app Area Variance - Residential $350/1st var +$50/app +$150/ea add variance Area Variance - Non-residential $1000/1st var + $50/app+ $200/ ea add variance Interpretations $650 + $50/app Application Fee x 2 + $50/app Variance extensions 50% of Application fee + $50/app Application to Design Review Commission Demolition $500 Residential Structures Principal $70 Accessory $70 Extension $35 Modification $55 Multi-Family, Comm, Mixed-Use Structures Sketch $200 Principal $650 Extension $250 Modification $400 Multi-Family, Comm, Mixed-Use Accessory, Signs, Awnings Principal $150 Extension $100 Modification $150 Application Fee x 2 Application to Planning Board Special Use Permit $1200 + $50/app Temporary Use Permit $500 Special Use Permit - extension $400 Special Use Permit - modification $550 + $50/app Site Plan Review - incl. PUD: Sketch Plan $400 per sketch Site Plan Full Residential $400 + $250/unit Non-residential $800 + $150/1000 sf Administrative SPR Residential $400 Non-residential $800 Extension Residential $250 Non-residential $350 Subdivision - incl. PUD: Sketch Plan $400 per sketch Preliminary Approval Residential: 1-5 lots $700 + $50/app Residential: 6-10 lots $1100 + $50/app Residential: 11-20 lots $1450 + $50/app Residential: 21+ lots $1800 + $50/app Residential - extension $350 Final Approval Residential $1,550 + $200/lot + $50/app Non- Residential $2,400/lot + $50/app Final Approval Modification Residential $400 + $50/app Non- Residential $800 + $50/app Final Approval Extension Residential $250 Non- Residential $350 Other: Lot Line Adjustment/Subdivision Administrative Action$400 Letter of Credit - modification or extension $400 Letter of Credit - collection up to 1% of LoC Recreation Fee $2000/lot or unit Land Disturbance $750 + $35/acre Watercourse/Wetland Permit $750 SEQRA EIS Review (Draft & Final) TBD Post Work Application Fee Post Work Application Fee OFFICE OF PLANNING AND ECONOMIC DEVELOPMENT FEES - 2023 City of Saratoga Springs OPED Fees Page 1 of 1 5 400 SERIES 2021-22 PRODUCT GUIDE FOR PROFESSIONALS *2020 Andersen brand survey of U.S. contractors. CONTRACTORSTRUST THE MOST.* THE WINDOWS 7 Printing limitations prevent exact duplication of colors. See your Andersen supplier for actual color samples. EXTERIOR TRIM SYSTEM Add curb appeal with Andersen® exterior trim. Our trim is made with Fibrex® composite material, an environmentally smart composite that contains 40% pre-consumer reclaimed wood fiber by weight. For details, see page 175. Sandtone window with cocoa bean trim SandtoneCanvasPrairie Grass TerratoneWhite Cocoa Bean Dark Bronze Red Rock BlackForest Green Dove Gray EXTERIOR COLORS Time saving and cost effective Innovative attachment strip No nail holes, no visible fasteners, no painting Independent of water management system for easy installation Style that gets noticed Our wide trim profiles overlap the window frame to create clean lines without visible sealant joints. Mitered brick mould corners and butt joints on flat casing profiles reflect traditional corner joints. Visit andersenwindows.com/exteriortrim to learn more. 12 Center of glass performance only. Ratings based on glass options as of May 2021. Visit andersenwindows.com/energystar for ENERGY STAR map and NFRC total unit performance data. *Andersen 400 Series products only with SmartSun glass with HeatLock coating (argon gas blend), no grilles, no capillary breather tubes. Excludes patterned/textured glass. “ENERGY STAR” is a registered trademark of the U.S. Environmental Protection Agency. lllm llll llmm llll lllm llll llmm llll GLASS OPTIONS Andersen has the glass you need to get the performance you want. From SmartSun™ glass with HeatLock® coating that’s ENERGY STAR® certified in all climate zones* to PassiveSun® glass that helps heat homes in northern areas, there’s an option for every climate, project and customer. Check with your supplier for selections that meet ENERGY STAR requirements in your area. ENERGY LIGHT How well a product blocks heat caused by sunlight. Visible Light Transmittance How much visible light comes through a product. UV Protection How well a product blocks ultraviolet rays.GLASS How well a product prevents heat from escaping. Solar Heat Gain CoefficientU-Factor lllm lmmm lllm lmmm lllm lllm lllm llll lmmm lllm For more details on our glass options, visit andersenwindows.com/glass. llmm llmm lmmm mmmm llll mmmm HEATLOCK TECHNOLOGY Applied to the room-side glass surface, HeatLock coating reflects heat back into the home for improved performance. ADDITIONAL GLASS OPTIONS Tempered safety glass is standard on patio doors and required for larger window sizes. Laminated glass is available for added strength, enhanced security and sound control. Patterned glass lets in light while obscuring vision and adds a unique, decorative touch. Cascade and Reed patterns can be ordered with either a vertical or horizontal orientation. TIME-SAVING FILM We protect our products during delivery and construction with translucent film on the glass that peels away for a virtually spotless window. STORMWATCH ® PROTECTION Most Andersen 400 Series windows are available with impact-resistant glass and structural upgrades to meet the tough building codes of hurricane-prone coastal areas. See your local code official for specific requirements. High visibility with basic thermal performance. Ideal for northern, passive solar construction applications where solar heat gain is desired. Applied to the room-side surface, it reflects heat back into the home and improves U-Factor values. Outstanding thermal control in southern climates where less solar heat gain is desired. Applied to the room-side surface, it reflects heat back into the home and improves U-Factor values. Thermal control similar to tinted glass, with visible light transmittance similar to Low-E4 glass. Applied to the room-side surface, it reflects heat back into the home and improves U-Factor values. PassiveSun with HeatLock Coating Clear Dual-Pane PassiveSun® Sun SmartSun with HeatLock Coating SmartSun™ Low-E4 with HeatLock® Coating Low-E4®Outstanding overall performance for climates where both heating and cooling costs are a concern. ART GLASS With art glass panels from Andersen, you can add interest, create focal points and make your work stand out. See page 173 or visit andersenwindows.com/artglass for more information. lllm lllm llmm lllm lllm lllm lllm lllm Cascade ObscureFern Reed Satin Etch *Visit andersenwindows.com/warranty for details. **Products with dark bronze and black interiors have matching exteriors. Dimensions in parentheses are in millimeters. Printing limitations prevent exact replication of colors and finishes. See your Andersen supplier for actual color and finish samples. Naturally occurring variations in grain, color and texture of wood make each window one of a kind. All wood interiors are unfinished unless a finish is specified. Distressed bronze and oil rubbed bronze are “living” finishes that will change with time and use. FRAME A A seamless one-piece, rigid vinyl frame cover is secured to the exterior of the frame to protect the wood frame from moisture and maintain an attractive appearance while minimizing maintenance. B The seamless rigid vinyl cover extends 1 3 ⁄8" (35) around the perimeter of the unit, creating a flange to help seal the unit to the structure. C Wood frame members are treated with a water-repellent preservative for long-lasting* protection and performance. D Interior stops are unfinished pine. Low-maintenance prefinished white, dark bronze and black** interiors are also available. SASH E Rigid vinyl encases the entire sash – a vinyl weld protects each sash corner for superior weathertightness. It maintains an attractive appearance and minimizes maintenance. F Wood core members provide excellent structural stability and energy efficiency. G Vinyl closed-cell foam weatherstrip is factory installed on the perimeter of the sash. GLASS H In addition to stainless steel glass spacers, black or white glass spacers are now available to allow the spacer to blend in with the unit color. I A glazing bead and silicone provide superior weathertightness and durability. J High-Performance options include: • Low-E4® glass • Low-E4 HeatLock® glass • Low-E4 SmartSun™ glass • Low-E4 SmartSun HeatLock glass • Low-E4 Sun glass Tempered and other glass options are available. Contact your Andersen supplier. A removable translucent film helps shield the glass from damage during delivery and construction, and simplifies finishing at the job site. Patterned Glass Patterned glass options are available. See page 12 for more details. HARDWARE Smooth Control Hardware System The smooth control hardware system employs a worm gear drive for easy operation. Units with a wash mode have hinges that move the sash away from the frame to provide easier glass cleaning. CXW15, CXW155, CXW16 and CXW25 sizes not available with wash mode. Hardware option and finish must be specified. Operator handle and cover sold separately. Single-Actuation Casement Lock On casement windows, a single- actuation lock easily releases all locking points on the casement sash while the reach-out action eliminates binding when closing. The lock handle is offered in finishes that coordinate with your specified hardware option. Awning Sash Locks Awning sash locks provide an added measure of security and weathertightness. Hardware style and finish options are compatible with Andersen® casement windows to ensure consistency in appearance when used in window combination designs. Dark Bronze BlackForest Green Terratone FEATURES EXTERIOR & INTERIOR OPTIONS HARDWARE OPTIONS Sold Separately White Canvas Sandtone EXTERIOR COLORS **Black** Pine White Dark **Bronze** INTERIOR OPTIONS TRADITIONAL FOLDINGCONTEMPORARY FOLDING Antique Brass | Black | Bright Brass Distressed Bronze | Distressed Nickel Gold Dust | Oil Rubbed Bronze Satin Nickel | Stone | White Black | Bright Brass | Gold Dust Oil Rubbed Bronze | Satin Nickel Stone | White ESTATE ™CLASSIC SERIES™ Antique Brass | Bright Brass Brushed Chrome | Distressed Bronze Distressed Nickel | Oil Rubbed Bronze Polished Chrome | Satin Nickel Stone | White Bold name denotes finish shown. HARDWARE FINISHES Stone Distressed Nickel Satin Nickel Bright Brass Gold Dust Brushed Chrome Polished Chrome White Antique Brass Oil Rubbed Bronze Distressed Bronze Black Folding handles avoid interference with window treatments. 400 Series casement and awning windows are available with Stormwatch® Protection. For more details, visit andersenwindows.com/coastal. Performance Grade (PG) Upgrades Performance upgrades are available for select sizes of standard, non-impact casement and awning windows, allowing these units to achieve higher performance ratings. Performance Grade (PG) ratings are more comprehensive than Design Pressure (DP) ratings for measuring product performance. Visit andersenwindows.com for up-to-date performance information of individual products. Contact your Andersen supplier for availability. 20 CASEMENT & AWNING WINDOWS B C D E G F J H I *Visit andersenwindows.com/warranty for details. **TruScene insect screens let in over 25% more fresh air than standard Andersen fiberglass insect screens. Dimensions in parentheses are in millimeters. FRAME Extension Jambs Standard jamb depth is 2 7 ⁄8" (73). Extension jambs are available in unfinished pine or prefinished white, dark bronze and black. Some sizes may be veneered. Factory-applied and non-applied interior extension jambs are available in 1 ⁄16" (1.5) increments between 4 9 ⁄16" (116) and 7 1 ⁄8" (181). Extension jambs can be factory applied to either three sides (stool and apron application) or four sides (picture frame casing). Thick Replacement Extension Jambs To help preserve original alignment of trim and paint lines in replacement situations, special 1 1 ⁄8" (29) thick replacement extension jambs are available. Factory-applied and non-applied extension jambs are available in 1 ⁄16" (1.5) increments between 4 9 ⁄16" (116) and 7 1 ⁄8" (181). Non-applied extension jambs are available in 12' (3658) lineals. Detail on page 34. Drywall Return Bead A drywall return bead is available in a narrow or wide dimension with unfinished pine or prefinished white, dark bronze and black interiors. Can be ordered factory applied or in non- applied lineals. Detail on page 34. HARDWARE Corrosion-Resistant Components Corrosion-resistant hinge and operator arm hardware is designed for applications in harsh and corrosive environments such as heavy industrial or coastal areas.* Window Opening Control Device A window opening control device is available, which limits sash travel to less than 4" (102) when the window is first opened. Available factory applied, or as a field-applied kit in white, stone and black. Power Operator for Awning Windows Awning windows can be ordered with an operator enhanced by PowerAssist™ technology that opens and closes the window with the touch of a button. Easy to install, the 24-volt system features a concealed window power drive, battery backup in case of a power outage and a moisture sensor that automatically closes the window when it rains. A wireless remote control is available (sold separately). The PowerAssist system is controlled by a wall-mounted console, which includes a power box, battery, touch pad and mounting bracket. Windows can be ordered factory prepped to save time, or they can be ordered as a field kit. Power driver requires field installation. PowerAssist technology eliminates the need for sash locks. Available for windows up to 5' (1524) wide. Not available for units with Stormwatch® Protection or performance upgrades. SPECIAL USE OPERATOR HANDLES Available in Classic Series™ design only. Compact Operator Handle Specially designed for use in situations where blinds or other window treatments interfere with standard operator handle. Available in white or stone finish. Easy-Grip Handle Larger knob makes it easier to grip and operate. Available in white or stone finish. Operator Spline Cover An operator spline cover is an attractive cap that covers the roto operator stud when the handle has been removed to control access or operation of the window. The operator spline cover should not be used on any window designated or intended for emergency escape or rescue. Please consult your local building code official for local egress code requirements. Metal T-Handle Our smallest operator handle, the metal T-handle, may make it more difficult for young children (5 and under) to open the window. For more information on child safety, write: Andersen Corporation LookOut For Kids® Program 100 Fourth Avenue North Bayport, MN 55003 Call 800-313-8889 or email lofk@andersencorp.com. GLASS Andersen® Art Glass Andersen art glass panels come in a variety of original patterns. See art glass section starting on page 173 for more information or visit andersenwindows.com/artglass. INSECT SCREENS TruScene® Insect Screens Andersen TruScene insect screens let in over 25% more fresh air** and provide 50% greater clarity than conventional Andersen insect screens, all while keeping out unwanted small insects. For casement and awning windows, frames are available in white, stone, dark bronze and black, or with pine veneer frame interiors to blend with the wood interior of the window. Conventional Insect Screens Conventional insect screens have charcoal powder-coated aluminum screen mesh. Available with frames in white, stone, dark bronze and black. GRILLES Grilles are available in a variety of configurations and widths. For casement and awning window grille patterns, see page 34. EXTERIOR TRIM Available with Andersen exterior trim. See exterior trim section starting on page 175. ACCESSORIES Sold Separately CAUTION: • Painting and staining may cause damage to rigid vinyl. • 400 Series windows in Terratone color may be painted any color lighter than Terratone color using quality oil-based or latex paint. • Do not paint 400 Series windows in white, canvas, Sandtone, dark bronze, forest green or black exterior colors. • Andersen does not warrant the adhesion or performance of homeowner-applied paint over vinyl or other factory-coated surfaces. • For vinyl painting instructions and preparation, contact your Andersen supplier. • Do not paint weatherstrip. • Creosote-based stains should not come in contact with Andersen products. • Abrasive cleaners or solutions containing corrosive solvents should not be used on Andersen products. 21 400 Series Casement & Awning Windows 400 SERIES • “Window Dimension” always refers to outside frame-to-frame dimension. • “Minimum Rough Opening” dimensions may need to be increased to allow for use of building wraps, flashing, sill panning, brackets, fasteners or other items. See pages 210-211 for more details. • Dimensions in parentheses are in millimeters. ◊Meet or exceed clear opening area of 5.7 sq. ft. or 0.53 m2, clear opening width of 20" (508) and clear opening height of 24" (610) with appropriate hinge specified. See tables on pages 29-30. *Meet clear opening width of 20" (508) using hinge with wash mode and control bracket (bracket can be pivoted for cleaning position) and meet clear opening width of 22" (559) using hinge for widest clear opening. **Available with straight-arm operators (hinged for widest clear opening) only. CR23 CR24 CR235 CR245 CR25 CR255 CR26CN16CR16C16CW16* CN155 CN15 CN145 CR155 CR15 CR145 CW155 *C155 CW145 * C15 C145 CW15 * CN14 CN135 CN13 CN125 CR135 CR14 CR13 CR125 CW135 *C135 CW14 *C14 CW125* C13 C125 CW13* CN12CR12 C12 CW12* CN26 CW26 *C26 C255 C245 CN25 CW25 *C25 C235CN235CXW135 CXW14 CN24 CXW13 CN23 CW235 * CW24 *C24 CW23*C23 CX125 CXW16 ** CXW155 **CN255 CXW15 ** CW255 * CW245 *CXW145 CN245 CX13 CX14 CX135 CX145 CX15 CX155 CX16 CN225 CW225*C225 CW22*C22 CTR2910CTR2010CTR2410CTR3010 CTR3410 CTR4810CTR4010CTR2810CTR1810CTR1510 CN22 CTR22410CTR22010CTR21810 Table of Casement and Transom Window Sizes 4'-8 1 ⁄2" 4'-9" 51 11 ⁄16" 4'-0" 4'-0 1 ⁄2" 43 3 ⁄16" 3'-4 3 ⁄4" 3'-5 1 ⁄4" 35 15 ⁄16" 2'-9 3 ⁄4" 2'-10 1 ⁄4" 28 15 ⁄16" 2'-4 3 ⁄8" 2'-4 7 ⁄8" 23 9 ⁄16" 2'-7 1 ⁄2" 2'-8" 2'-0 1 ⁄8" 2'-0 5 ⁄8" 19 5 ⁄16"5'-11 7⁄8"6'-0 3⁄8"67 1⁄16"4'-11 7⁄8"5'-0 3⁄8"55 1⁄16"4'-0"4'-0 1⁄2"43 3⁄16"3'-4 13⁄16"3'-5 3⁄8"36"2'-11 15⁄16"3'-0 1⁄2"31 1⁄8"4'-4 13⁄16"4'-5 3⁄8"48"5'-4 13⁄16"5'-5 3⁄8"60"Window Dimension Unobstructed Glass (transom, single sash only)2'-0 1⁄8"2'-0 5⁄8"1'-0 1⁄2"19 5⁄16"1'-0"7 3⁄16"23 9⁄16"2'-4 3⁄8"2'-4 7⁄8"2'-11 15 ⁄16" 3'-0 1 ⁄2" 31 1 ⁄8"26 11 ⁄16" 19 3 ⁄4"24"16 1 ⁄8"12 5 ⁄8"19 3 ⁄4"Unobstructed Glass (casement, single sash only) 31 9 ⁄16"27 1 ⁄8"24"1'-0 1⁄2"1'-0"7 3⁄16"1'-8 1 ⁄2" 1'-9" 15 11 ⁄16" 1'-5" 1'-5 1 ⁄2" 12 3 ⁄16" 16 1 ⁄8"12 5 ⁄8" Minimum Rough Opening CUSTOM WIDTHS — 17" to 84 5 ⁄8" CUSTOM WIDTHS — 17" to 35 15 ⁄16" CUSTOM HEIGHTS — 24 1⁄8" to 71 7⁄8" 12"Scale 1 ⁄8" (3) = 1'-0" (305) — 1:96 (613) (625) (491) (721) (733) (599) (800) (813) (678) (857) (870) (735) (1035) (1048) (913) (1219) (1232) (1097) (1435) (1448) (1313) (913) (927) (791) (502)(610)(689)(321)(410)(502)(610)(802) (432) (445) (310) (521) (533) (398) (321)(410)(613)(625)(491)(305)(318)(183)(305)(318)(183)(913)(927)(791)(1037)(1051)(914)(1219)(1232)(1097)(1341)(1356)(1219)(1521)(1534)(1399)(1646)(1660)(1524)(1826)(1838)(1703)(721)(733)(598)C35 C335 C34 C33CN33 C345 CN35 CN335 CN34 CN345 CX23 CW35 * CW335 * CW34 * CW33* CW345 * CXW25 ** CXW235 CXW24 CXW23 CXW245 CX235 CX24 CX245 CX25 CTR22810 CTR23010 CTR5210 CTR51110 CTR5110 CTR6010 CTR7010 C325CN325 CW325* C32CN32 CW32* CTR32010CTR31810 CTR32410 5'-11 5 ⁄8" 6'-0 1 ⁄8" 66 13 ⁄16" 5'-2 3 ⁄4" 5'-3 1 ⁄4" 57 15 ⁄16" 5'-11 7⁄8" 6'-0 3 ⁄8" 67 1 ⁄16" 7'-0 5 ⁄8" 7'-1 1 ⁄8" 79 13 ⁄16" 27 1 ⁄8"31 9 ⁄16"19 3 ⁄4"16 1 ⁄8"24" 56 3 ⁄16" 5'-1" 5'-1 1 ⁄2" (1819) (1697) (1832) (1594) (1472) (1607) (1826) (1703)(1427) (1838) (2149) (2027) (2162) (689)(802)(502)(410)(610) (1549) (1562) 24 CASEMENT & AWNING WINDOWS Specifications are subject to change without notice. © 2023 Mitsubishi Electric Trane HVAC US LLC. All rights reserved. Job Name: System Reference:Date: Indoor Unit MFZ-KJ09NA Outdoor Unit MUFZ-KJ09NAHZ INDOOR UNIT FEATURES •Floor-mounted indoor unit mounts on the floor or up to 5” above the floor •Floor front panel access to the filter for ease of cleaning •Perfect for difficult areas that may be smaller or don’t have usable space on the walls •Multiple fan speed options: Low, Medium, High, Powerful, Auto •Quiet operation •Multi-flow vane for faster heating •Multiple control options available: ○Hand-held Remote Controller (provided with unit) ○kumo cloud® smart device app for remote access ○Third-party interface options ○Wired or wireless controllers •Unit can be recessed mounted into wall OUTDOOR UNIT FEATURES •Built-in base pan heater MFZ-KJ09NA & MUFZ-KJ09NAHZ9,000 BTU/H FLOOR-MOUNTED INDOOR UNIT9,000 BTU/H HYPER-HEATING OUTDOOR UNIT Specifications are subject to change without notice. © 2023 Mitsubishi Electric Trane HVAC US LLC. All rights reserved. Unit: inch INDOOR UNIT DIMENSIONS: MFZ-KJ09NA FORM# MFZ-KJ09NA & MUFZ-KJ09NAHZ - 202304 1340 Satellite Boulevard Suwanee, GA 30024 Toll Free: 800-433-4822 www.mehvac.com Specifications are subject to change without notice. © 2023 Mitsubishi Electric Trane HVAC US LLC. All rights reserved. clear *1*1 4 in. or more when front and sides of the unit are clear *2 When any 2 sides of left, right and rear of the unit are clear 2 x hole 3/8 x 13/16 REQUIRED SPACE Liquid refrigerant pipe joint Refrigerant pipe (flared) Ø 1/4 Gas refrigerant pipe joint Refrigerant pipe (flared) Ø 3/8 4 in. or more 14 in . o r m o r e8 in. or m or e * 2 4 in. o r m o r e Unit: inch OUTDOOR UNIT DIMENSIONS: MUFZ-KJ09NAHZ VICINITY MAPANDATCENTERLINEPOUND, NUMBERAIR CONDITIONINGACOUSTICALACOUSTICAL CEILING TILEADDITIONADJACENTABOVE FINISHED FLOORSAIR HANDLING UNITSALTERNATEALUMINUMANCHORANGLEANODIZEDAPPROXIMATEARCHITECTASSOCIATEDBOTTOMBALLED AND BURLAPPEDBOTTOM OFBOARDBITUMINOUSBUILDING LINEBUILDINGBLOCK(ING)BEAMBENCH MARKBEARINGBRICKBASEMENTBUILT-UP ROOFINGCABINETCALIPERCATCH BASINCEILING DIFFUSERCEMENTCUBIC FEET PER MINUTECORNER GUARDCAST IRONCONTROL JOINTCEILINGCLEARCONCRETE MASONRY UNITCLEAN OUTCOLUMNCONCRETECONNECTIONCONSTRUCTIONCONTINUOUSCONTRACT(OR)CARPETCEILING REGISTERCERAMIC TILECENTERCONDENSING UNITCABINET UNIT HEATER"CUSPIDORCOLD WATERDOUBLEDETAILDRINKING FOUNTAINDIAMETERDIMENSION&@#A/CACOUSACTADDNADJAFFAHUALTALANCHANGANODAPPROXARCHASSOCBOTB&BB.O.BDBITBLBLDGBLK'GBMBMBRGBRKBSMTBURCABCALCBCDCEMCFMCGCICJCLGCLRCMUCOCOLCONCCONNCONSTCONTCONTRCPTCRCTCTRCUCUHCUSPCWDBLDETDFDIADIMDISPENSERDEAD LOADDRAINAGE MANHOLEDOWNDISTRIBUTION PANELDOORDOWNSPOUTDRAWINGEASTEACHEPOXY FLOORINGEXTERIOR INSULATIONFINISH SYSTEMEXPANSION JOINTELEVATIONELECTRICALEMERGENCYENCLOSUREENGINEERELECTRICAL PANEL"ETHYlENE PROPYLENE DIENE MONOMEREQUALEQUIPMENTELECTRIC WATER COOLERELECTRIC WATER HEATEREXHAUSTEXISTINGEXPANSIONEXTERIORFIRE ALARMFIRE ALARM CONTROL PANELFLOOR DRAINFOUNDATIONFIRE EXTINGUISHERFIRE EXTINGUISHER CABINETFINISHED FLOORFINISHED GRADEFIRE HOSE CABINETFINISH(ED)FIXTUREFLOW LINEFLASHINGFLOOR(ING)FLUORESCENTFACE OFFIREPROOFFIRE PROOFFIBER REINFORCED PANELFLOOR SINKFOOT, FEETFOOTINGFURNISH(ED)FURRINGFABRIC WALL COVERINGGAUGE, GAGEGALVANIZEDGENERAL CONTRACTORGROUND FAULT INTERRUPTERGYPSUMHOSE BIBBHOLLOW COREHARDWOODDISPDLDMHDNDPDRDSDWGEEAEFEIFSEJELELECEMERGENCLENGREPEPDMEQEQUIPEWCEWHEXHEXISTEXPEXTFAFACPFDFDNFEFECFFFGFHCFINFIXTFLFLASHFLR(G)FLUORFOFPFPRFRFSFTFTGFURNFRRFWCGAGALVGCGFIGYPHBHCHDWDHARDWAREHEIGHTHIGH INTENSITY DISCHARGEHOLLOW METALHORIZONTALHEAT, VENT, A/CHOT WATERINSIDE DIAMETERINCHINCANDESCENTINCLUDE (D) (ING)INSULAT(ED)(ION)INTERIORINVERTJUNCTION BOXJOINTKIP (1,000 POUNDS)KIP FEETLAMINATEDLAVATORYPOUND(S)LEAD COATED COPPERLINEAR FEETLEFT HANDLIVE LOADLONG LEG HORIZONTALLONG LEG VERTICALLIGHTING PANELLIGHT (ING)LIGHTWEIGHTMASONRYMAXIMUMMAIN DISTRIBUTION PANELMECHANICALMEDIUMMEMBRANEMETALMANUFACTURERMANHOLEMINIMUMMISCELLANEOUSMASONRY OPENINGMOUNTEDNORTHNOT IN CONTRACTNUMBERNOMINALNOT TO SCALEON CENTER(S)OUTSIDE DIAMETEROPEN ITEMOPENINGOPPOSITEOUNCEPROJECT ARCHITECTPOUNDS PER CUBIC FOOTPERFORATEDHDWRHGTHID HMHORIZHVACHWIDININCANDINCLINSULINTINVJBJTKK-FTLAMLAVLB(S)LCCLFLHLLLLHLLVLPLT(G)LTWTMASMAXMDPMECHMEDMEMBMTLMFRMHMINMISCMOMTDNNICNO.NOMNTSOCODOIOPGOPPOZPAPCFPERFPLATEPLASTIC LAMINATEPLASTERPLUMBINGPOUNDS PER LINEAR FOOTPLYWOODPANELPOLISH(ED)POWER PANELPAIRPROJECTPARTITIONPOUNDS PER SQUARE FOOTPOUNDS PER SQUARE INCHPOINTPAINTEDPLUMBING VENTPOLYVINYL CHLORIDEPAVEMENTQUARRY TILEQUANTITYRADIUSRUBBER BASEREFLECTED CEILING PLANROOF DRAINREFERRECEPTACLEREFERENCEREINFORCE (D) (ING)REQUIREDRESILIENTREVISIONS, REVISEDROOFINGRIGHT HANDROOMROUGH OPENINGRIGHT OF WAYRESTROOMROOF TOP UNITRAIN WATER LEADERROOF VENTSOUTHSANITARYSUSPENDED ACOUSTICAL TILESOLID CORESCHEDULESTORM DRAINSECTIONSERVICESQUARE FEETSHEETSIMILARSANITARY MANHOLESPRAY ON VINYLSPECIFICATIONSSQUARESOLID SURFACESTAINLESS STEELSTANDARDSTEELSTORAGESTRUCTURALSUSPENDEDSYMMETRICALSYSTEMPLPLAMPLASPLBGPLFPLYWDPNLPOLPPPRPROJPRTNPSFPSIPTPTDPVPVCPVMTQTQTYRRBRCPRDRERECPTREFREINFREQRESILREVRFGRHRMROROWRRRTURWLRVSSANS.A.T.SCSCHEDSDSECTSERVSFSHTSIMSMHSOVSPECSQSSSSTLSTDSTLSTORSTRUCTSUSPSYMSYSTTREADTOP OFTONGUE AND GROOVETELEPHONETEMPERATURE, TEMPEREDTHICKTHRESHOLDTHE NEENAN COMPANYTOILET PARTITIONTRANSISTION STRIPTYPICALTELEVISIONUNDERGROUNDUNIT HEATERUNLESS NOTED OTHERWISEUNFINISHEDULTRA VIOLETVINYL COMPOSITION TILEVERTICALVENTILATORVERIFY IN FIELDVINYL WALL COVERINGWESTWITHWITHOUTWATER CLOSETWOODWATER HEATERWATERPROOFWORK POINTWATER RESISTANTWAINSCOTWEIGHTWATER VALVEWELDED WIRE FABRICYARDTT.O.T&GTELTEMPTHKTHRESTNCTPTSTYPTVUGUHUNOUNFINUVVCTVERTVENTVIFVWCWW/W/OWCWDWHWPWPTWRWSCTWTWVWWFYDMATERIAL KEYDRAWING INDEXABBREVIATIONS1Room101DETAILSECTIONDOOR NUMBERWINDOW NUMBERWALL TYPECOLUMN GRIDREVISIONROOM NAME & NUMBERLEVELGRAPHIC SYMBOLSELEVATION101AAAA1.011SIM1A1A3A2A4A101A1.011SIMEL 0'-0"?D1KEYNOTEPROJECT LOCATIONGENERAL NOTES:1. Federal Copyright Law protects these plans. Reproduction or modification of these plans without the written consent of Charette Associates Architects, P.C. (CAA), is strictly prohibited.2. Construction shall conform to the latest edition of the Building Code of New York (BCNY) and the Energy Conservation Construction Code of New York State, with possible modification by local code administration. 3. Construction documents for this work have been prepared in accordance with generally accepted architectural and engineering practice to meet minimum requirements of the latest edition of the BCNYS.4. Do not scale drawings. Use dimensions as indicated for all locations.5. In the event of conflict between pertinent codes and regulations and referenced standards of these drawings and specifications, the more stringent provisions shall govern.6. Contractor shall be responsible for all materials, construction methods, craftsmanship, procedures and conditions (including safety).7. Contractor shall verify all existing conditions, requirements, notes, and dimensions shown on Drawings or noted in Specifications. Any variances within drawings and Specifications, or with conditions encountered at job site, shall be reported in writing to CAA before commencement of any work affected by such variance.8. Contractor shall rigidly adhere to all laws, codes, and ordinances, which apply to this work. Contractor shall notify and receive written clarification from CAA of any variations between contract documents and governing regulations.9. The Contractor shall make no structural changes without written approval of CAA.10. Deviations from these drawings which are not performed with prior written consent from the architect are solely at the contractor's risk and he/she shall accept full liability for same.11. CAA has not been engaged for construction services and assumes no responsibility for construction conformance, means, methods, techniques or procedures of on-site work relating to the construction plans.12. Contractor shall investigate site during clearing and earthwork operations for filled excavations or buried structures such as cesspools, cisterns, foundations, etc. If any such items are found and affect the ability to adhere to the construction documents, CAA shall be notified for revised specifications.13. All manufactured materials, components, fasteners, assemblers, etc., shall be handled and installed in accordance with manufacturer’s instructions and provisions of applicable industry standards. Where specific manufactured products are called for, generic equals that meet applicable standards and specifications may be used.14. Construction loads shall not overload structure nor shall they be in excess of design loadings indicated herein.15. Design of electric, plumbing, and HVAC systems by others. Verify location of existing utilities/services prior to construction.16. Drawings and specifications are intended to provide the basis for the proper completion of the Project suitable for the intended use of the Owner.17. Items not expressly set forth but which are reasonably implied or necessary for the proper performance of this work shall be included.18. Submit for approval all submittals listed in the documents. Include details of construction and adjacent construction in shop drawings. Clearly indicate any deviations from requirements of the contract documents. Fabricate materials from approved shop drawings only.19. Comply with applicable codes, regulations, ordinances and requirements of authorities having jurisdiction. Submit copies of inspection reports, notices and similar documents to Architect.20. Provide products of acceptable manufacturers which have been in satisfactory use in similar service for three years.21. Use experienced installers. Furnish evidence of experience if requested.22. Deliver, handle, and store materials in strict accordance with manufacturer's instructions.23. Inspect substrates and report unsatisfactory conditions in writing.24. Do not proceed until unsatisfactory conditions have been corrected.25. Take field measurements prior to fabrication where practical. Form to required shapes and sizes with true edges, lines and angles. Provide inserts and templates as needed for work of other trades.26. Install materials in exact accordance with manufacturer's instructions and approved submittals. 27. Install materials in proper relation with adjacent construction and with proper appearance.28. Contractor shall provide all labor, materials and equipment necessary to install plumbing, related fixtures, ventilations, floor drains, heating and mechanical systems. All work shall comply with state and local codes and ordinances. Terminal hookup of all fixtures and tap in to all utilities is required. Contractor shall install and check all pressure-reducing valves, pop off valves and other safety devices prior to operations of systems.29. Contractor shall provide and install all labor, materials and equipment necessary to install wiring, related fixtures, electric heat elements, and control. All work shall comply with National Electrical Code. Terminal hookup is required of all fixtures and appliances, motors, fans, and controls. 30. Electrical system layouts, if included in construction documents, are generally diagrammatic, locations of outlets and equipment is approximate. Exact routing of wiring, locations of outlets shall be governed by structural conditions and obstructions. Wiring for equipment requiring maintenance and inspection shall be readily accessible. ALUMINUMBATT INSULATIONCAST-IN-PLACE CONCRETECONCRETE BLOCKDIMENSIONAL LUMBEREARTHEXISTING TO REMAINEXPANSION MATERIALFINISHED WOODMINERAL WOOL INSULATIONPLYWOODRIGID INSULATIONSTEELSTONEWOOD BLOCKING; SHIMGRAVELGROUT; MORTARGYPSUM WALLBOARD (GWB)6DCBA354321654321REVISIONS:Architects, P.C.Designed By:CHARETTE ASSOCIATESNotice:The drawings, plans, specifications and designs contained herein are and shall remain the exclusive property of Charette Associates Architects, P.C., and cannot be altered, copied, duplicated or used directly or indirectly in whole or in part except with the express written permission of Charette Associates Architects, P.C. Copyright 2023PROJECTDESIGNEDDRAWNDRAWING TITLESEALCHECKEDAPPROVEDDATEPROJECT NO.SCALEDRAWING NO.Gansevoort, New YorkPhone (518) 265-2628 Fax (518) 581-0530As indicatedRENOVATE APARTMENT #9282 Ballston AvenueSaratoga Springs, NY 12866TITLE SHEETT-0012301LALALAJK/AK12/28/23SHEET NO.DRAWING NAMEG-001CODE DATAC-101SITE PLANAD-101REMOVAL PLANSA-101FLOOR PLANSA-501DETAILSA-801MATERIAL SPECS & STRUCT. NOTES DWGFCIGFCIGFCIGFCIT 33STTSS2020 NYS EXISTING BUILDING CODE CHAPTER 13 -PERFORMANCE COMPLIANCE METHODS:1301.1 SCOPETHE PROVISIONS OF THIS CHAPTER SHALL APPLY TO THE ALTERATION, ADDITION AND CHANGE OF OCCUPANCY OF EXISTING STRUCTURES, INCLUDING HISTORIC STRUCTURES, AS REFERENCED IN SECTION 301.3.3.THE PROVISIONS OF THIS CHAPTER ARE INTENDED TO MAINTAIN OR INCREASE THE CURRENT DEGREE OF PUBLIC SAFETY, HEALTH AND GENERALWELFARE IN EXISTING BUILDINGS WHILE PERMITTING, ALTERATION, ADDITION AND CHANGE OF OCCUPANCY WITHOUT REQUIRING FULL COMPLIANCE WITH CHAPTERS 6 THROUGH 12, EXCEPT WHERE COMPLIANCE WITH OTHER PROVISIONS OF THIS CODE IS SPECIFICALLY REQUIRED IN THIS CHAPTER.1301.2.2 PARTIAL CHANGE IN OCCUPANCYWHERE A PORTION OF THE BUILDING IS CHANGED TO A NEW OCCUPANCY CLASSIFICATION AND THAT PORTION IS SEPARATED FROM THE REMAINDER OF THE BUILDING WITH FIRE BARRIER OR HORIZONTAL ASSEMBLIES HAVING A FIRE-RESISTANCE RATING AS REQUIRED BY TABLE 508.4 OF THE BUILDING CODE OF NEW YORK STATE OR SECTION R302 OF THE RESIDENTIAL CODE OF NEW YORK STATE FOR THE SEPARATE OCCUPANCIES, OR WITH APPROVED COMPLIANCE ALTERNATIVES, THE PORTION CHANGED SHALL BE MADE TO CONFORM TO THE PROVISIONS OF THIS SECTION.SCOPE OF WORK REQUIRED FOR COMPLIANCE:THE FOLLOWING ITEMS ARE TO BE PROVIDED TO ACHIEVE COMPLIANCE OF APARTMENT #9 WITH CHAPTER 13, AS PER 10/17/2023 AGREEMENT WITH THE SARATOGA SPRINGS CODE AND BUILDING DEPARTMENTS:1. PROVIDE 1 HOUR FIRE SEPARATION HORIZONTALLY AND VERTICALLY BETWEEN APARTMENT #9 AND ADJACENT APARTMENTS (#6,7 &8)2. PROVIDE VERIFICATION TO CODE OFFICIALS THAT EXISTING BUILDING ELECTRICAL SYSTEM IS IN COMPLIANCE WITH NFPA 70.3. PROVIDE MECHANICAL VENTILATION (MINI-SPLIT SYSTEM) TO UNIT #9 HABITABLE AND OCCUPIED SPACES.4. ADD EMERGENCY ESCAPE WINDOWS TO HABITABLE SPACES IN APARTMENT #9BY PROVIDING EGRESS WINDOW WELLS.5. REPLACE WINDOWS INDICATED WITH WINDOWS SIZED FOR LIGHT, VENTILATION AND EGRESS. 6. NEW WINDOWS SHALL MEET 2020 ENERGY CONSERVATION CONSTRUCTION CODE OF NYS.7. PROVIDE A FIRE ALARM SYSTEM IN APARTMENT #9.8. PROVIDE SMOKE DETECTORS IN APARTMENT #9. NOTE THAT A CARBON MONIXIDE DETECTOR IS NOT REQUIRED, AS THERE IS NO SOURCE OF CARBON MONIXIDE IN THE BUILDING IN ACCORDANCE WITH THEEXCEMPTION TO 2020 NYSFC SECTION 915.2.1.9. REPLACE STAIR TYO APARTMENT #9 WITH ONE THAT COMPLIES WITH 2020 BUILDING CODE OF NYS SECTIONS 1011.5 & 1011.11.10. PROVIDE A KNOX BOX WITH A MASTER KEY, OR INDIVIDUAL APARTMENT KEYS, IN A LOCATION ACCESSIBLE TO THE FIRE DEPARTMENT.TABLE 1301.7 -SUMMARY SHEETExisting occupancy: R2Proposed occupancy: R2 Year building was constructed:1972Number ofstories: 2 / Height in feet: 30 Type of construction: 5b Area per floor: 1st FL –4352 2nd FL -4608Percentage of open perimeter increase: 100%Completely suppressed:Yes No X Corridor wall rating: n/a Type: n/a Compartmentation:Yes No XRequired door closers:Yes No X Fire-resistance rating of vertical opening enclosures: n/a Type of HVAC system: electric baseboard , serving number of floors: individual apartments Automatic fire detection:Yes X No Type and location: smoke detectors in each unit Fire alarm system:Yes No X Type: n/a Smoke control:Yes No X Type: n/a Adequate exit routes:Yes X No Dead ends: n/a Yes No X Maximum exit access travel distance: 54’Elevator controls:Yes No X Means of egress emergency lighting:Yes No X Mixed occupancies:Yes No X Standpipes:Yes No X Patient ability for self-preservation: n/a Incidental use:Yes No X Patient concentration: n/a Smoke compartmentation > 22,500 sf:Yes No X Attendant-to-patient ratio: n/a SAFETY PARAMETERSFIRE SAFETY (FS)MEANS OF EGRESS (ME)GENERAL SAFETY (GS)1301.6.1Building height0001301.6.2Building area24.924.924.91301.6.3Compartmentation1616161301.6.4Tenant and dwelling unit separations0001301.6.5Corridor walls-3-3-31301.6.6Vertical openings-14-14-141301.6.7HVAC systems5551301.6.8Automatic fire detection6661301.6.9Fire alarm system0001301.6.10Smoke control* * * *001301.6.11Means of egress* * * *001301.6.12Dead ends* * * *221301.6.13Maximum exit access travel distance* * * *16161301.6.14Elevator control-2-2-21301.6.15Means of egress emergency lighting* * * *001301.6.16Mixed occupancies0* * * *01301.6.17Automatic sprinklers-6÷ 2 = -3-61301.6.18Standpipes0001301.6.19Incidental use0001301.6.20Smoke compartmentation0001301.6.21.1Patient ability for self-preservation* * * *001301.6.21.2Patient concentration* * * *001301.6.21.3Attendant-to-patient ratio* * * *00Building score—total value26.947.944.9* * * *No applicable value to be inserted.TABLE 1301.8MANDATORY SAFETY SCORESOCCUPANCYFIRE SAFETY (MFS)MEANS OF EGRESS (MME)GENERAL SAFETY (MGS)R213838TABLE 1301.9EVALUATION FORMULASaFORMULAT1301.7T1301.8SCOREPASSFAILFS -MFS ≥026.9 (FS) -21 (MFS) =5.9XME -MME ≥047.9 (ME) -38 (MME) =9.9XGS -MGS ≥044.9 (GS) -38 (MGS) =6.9Xa.FS = Fire Safety.MFS = Mandatory Fire Safety.ME = Means of Egress.MME = Mandatory Means of Egress.GS = General Safety.MGS = Mandatory General Safety.APPLICABLE BUILDING CODES1. EXISTING BUILDING CODE OF NEW YORK STATE EBCNYS -2020 -CHAPTER 13.2. ENERGY CONSERVATION CODE OF NEW YORK STATE ECCNYS -2020CODE COMPLIANCE ANALYSISALLOWEDACTUALOCCUPANCY ALL R-2CONSTRUCTION ALL 5ANO. OF STORIES 2 2AREA 7,000 SF 4,608 SFHEIGHT 40' 30'SPRINKLERS NOT REQUIRED NOT REQUIREDEGRESS COMPONENT WIDTH ANALYSISOCC.WIDTH REQ'DWIDTH PROVIDEDAPARTMENT #9≤10 10 * 0.3 = 3" 36"NOTE:0.2" PER OCCUPANT FOR EGRESS COMPONENTS OTHER THAN STAIRSMAXIMUM TRAVEL DISTANCESCOMMON PATH OF TRAVEL:ALLOWABLE MAXIUM = 125'ACTUAL MAXIMUM = 54'*EXIT ACCESS TRAVEL DISTANCEALLOWABLE MAXIMUM = 200'ACTUAL MAXIMUM = 54'*PLUMBING FIXTURE ANALYSISR-2 OCCUPANCYWC LAV TUBKITCHEN WASHERSHOWERSINKCONNECTIONFIXTURES REQUIRED 1 1 111FIXTURES PROVIDED 1 1 1 11ENERGY CODETO THE BEST OF MY KNOWLEDGE, BELIEF AND PROFESSIONAL JUDGEMENT, THE DRAWINGS AND SPECIFICATIONS HAVE BEEN DESIGNED IN ACCORDANCE WITH THE 2020 ENERGY CONSERVATION CODE OF NYS (ECCNYS). ALL NEW CONSTRUCTION SHALL COMPLY WITH THIS CODE.. EXISTING CONSTRUCTION TO REMAIN SHALL NOT BE REQUIRED TO COMPLY WITH THE 2020 ECCNYS.ROOM101150 SF10036"240Travel Dist.LengthEXITCODE COMPLIANCE EGRESS ANAYLSIS SYMBOL LEGENDROOM NAMEROOM NUMBERSQUARE FOOTAGENO. OF OCCUPANTSEGRESS COMPONENT WIDTH IN INCHESEGRESS CAPACITY IN OCCUPANTSTRAVEL DISTANCE TO EXIT COMPONENTEXIT DISCHARGE1 HR FIRE RATED CONSTRUCTIONBEDROOM168 SF9-111GREAT ROOM294 SF9-032WALK-IN114 SF9-091BATHROOM62 SF9-071ENTRY9-01KITCHEN150 SF9-021EGRESS WINDOW WELL180EXITEXITEMERGENCYTravel Dist.51' -10"Travel Dist.35' -10"Travel Dist.46' -0"Travel Dist.44' -10"Travel Dist.28' -8"18036"36"Travel Dist.53' -2"Travel Dist.17' -10"Travel Dist.13' -4"6DCBA354321654321REVISIONS:Architects, P.C.Designed By:CHARETTE ASSOCIATESNotice:The drawings, plans, specifications and designs contained herein are and shall remain the exclusive property of Charette Associates Architects, P.C., and cannot be altered, copied, duplicated or used directly or indirectly in whole or in part except with the express written permission of Charette Associates Architects, P.C. Copyright 2023PROJECTDESIGNEDDRAWNDRAWING TITLESEALCHECKEDAPPROVEDDATEPROJECT NO.SCALEDRAWING NO.Gansevoort, New YorkPhone (518) 265-2628 Fax (518) 581-0530As indicatedRENOVATE APARTMENT #9282 Ballston AvenueSaratoga Springs, NY 12866CODE DATAG-0012301LALALAJK/AK12/28/23OCCUPANCY TABULATION PER 2020 BCNYS TABLE 1004.5RM. NO. ROOM NAMEOCCUPANCYTYPEAREALOADFACTOR(GSF)# OF OCCUPANTSPERMITTED9-02 KITCHENRESIDENTIAL 150 SF20019-03 GREAT ROOMRESIDENTIAL 294 SF20019-11 BEDROOMRESIDENTIAL 168 SF20013LIGHT AND VENTILATION REQUIREMENTSRoom NumberRoom NameArea Required Light Actual LightRequiredVentilationActualVentilation9-02KITCHEN150 SF12.0 SF *6.0 SF*9-03GREAT ROOM294 SF23.5 SF 38.8 SF 11.8 SF27.8 SF9-11BEDROOM168 SF13.5 SF 15.2 SF 6.7 SF14.2 SF9-12SUNROOM130 SF10.4 SF 20.5 SF 5.2 SF10.3 SF9-13SUNROOM169 SF13.5 SF 30.7 SF 6.8 SF15.3 SFNOTES:1. * INDICATES THAT LIGHT AND VENTILATION PROVIDED HAS BEEN COMBINED WITH THE ADJOINING GREAT ROOM AS A TOTAL FOR BOTH SPACES, IN ACCORDANCE WITH 2020BCNYS SECTIONS 1202.5.1.1 & 1204.2.1.2. KITCHEN AND GREAT ROOM UTILIZE BORROWED LIGHT AND VENTILATION FROM THE SUNROOMS. a. SUNROOM 9-12 PROVIDES 20.5 SF (LIGHT) AND 10.3 SF (VENT). b. SUNROOM 9-13 PROVIDES 30.7 SF (LIGHT) AND 15.3 SF (VENT). 40.3' 3.9' 7.1'26.6'asphalt parkinglotasphalt parkinglotplanterplanterplanterwood fence (typ.) chain-link fence conc. conc. step (typ.) concrete concrete bilco door Ballston Avenue (N.Y.S. Rt. 50)Peck Avenue1.079 ac. 2 STY. WOOD FRAME BUILDING BUILDINGHOUSEover- hang overhang 2nd floor overhang Clarendon Avenue (paper street)Joel A. and Nancy A. FondaL1044 P341James FortinoL1608 P609(map filed in Bk 1382 P771)Michael A. andMary Pat DonlickL1645 P720Joel A. and Nancy A. Fonda L1044 P343 Joel A. and Nancy A. Fonda L1044 P341 Joel A. and Nancy A. FondaL1044 P345Joel A. andNancy A. FondaL1312 P330N43°00'00"W200.00'50.00' S47°00'00"W N43°00'00"W170.00'100.00' S47°00'00"W 370.00'S43°00'00"EN47°00'00"E 150.00'70.00' 2" IP 1/2"IR. 1 1/4"IP.1/2"IR.1/2"IR. 1/2"IR.1/2"IR. 5/8"IR. nail setin asphalt 5/8"IR. 1 1/4" IP KNOX BOX -LOCATE IN FIELD. FINAL LOCATION TO BE COORDINATED WITH SARATOGA SPRINGS FIRE DEPARTMENT PRIOR TO INSTALLATION.A-101C1ALTERNATE LOCATION FOR KNOX BOX-TO BE APPROVED BY SARATOGA SPRINGS FIRE DEPARTMENT PRIOR TO INSTALLATION.SURVEY INFORMATION:SITE INFORMATION FROM SURVEY CONDUCTED BY THOMPSON FLEMING LAND SURVEYORS, P.C., TITLED MAP OF LANDS OF JOHN E. AND M. ANN KRASNICKI SITUATE AT 282 BALLSTON AVENUE, CITY OF SARATOGA SPRINGS, SARATOGA COUNTY, NY, DATED 4/20/2007 -JOB NO. S07-134.17.TAX MAP #178.41-2-26 DEED REFERENCE: JOHN E. KRASNICKI AND M. ANN KRASNICKI L1454 P589MAP REFERENCES: "MAP OF PINEHURST SUBDIVISION OF LANDS OF E.A. & E.P. SHACKELFORD" PREPARED BY J.S. MOTT DATED 1903 AND FILED IN THE SARATOGA COUNTY CLERK'S OFFICE ON AUGUST 23, 1903 AS MAP #FF-34.6DCBA354321654321REVISIONS:Architects, P.C.Designed By:CHARETTE ASSOCIATESNotice:The drawings, plans, specifications and designs contained herein are and shall remain the exclusive property of Charette Associates Architects, P.C., and cannot be altered, copied, duplicated or used directly or indirectly in whole or in part except with the express written permission of Charette Associates Architects, P.C. Copyright 2023PROJECTDESIGNEDDRAWNDRAWING TITLESEALCHECKEDAPPROVEDDATEPROJECT NO.SCALEDRAWING NO.Gansevoort, New YorkPhone (518) 265-2628 Fax (518) 581-0530As indicatedRENOVATE APARTMENT #9282 Ballston AvenueSaratoga Springs, NY 12866SITE PLANC-1012301LALALAJK/AK12/28/23SCALE:1" = 20'-0"SITE PLANA1 UPDWGFCIGFCIGFCIGFCITTTTT SSSDNGFCID3D1D1D1D6D3D8D4D2D2D1D1D1D8D5D5D7D5D5D5D5D5D7D11D11D11D12D11D12D13D13D13D13D11D11D12D12D1D12D5D5D5D5D5D5D5D5D5D7D5D14D14D4D8D2D10D1D4D4D8D8D14D6D9D9D15D10PLAN SYMBOL LEGENDCHARD-WIRED, INTERCONNECTED COMBINATION SMOKE DETECTOR/CARBON MONIXIDE DETECTOR Room101DOORNEW WALL & TYPE SYMBOL -SEE WALL TYPE SCHEDULEROOM NAME & NUMBER -SEE FINISH SCHEDULEWINDOW W1?D1EXISTING CONSTRUCTION TO REMAINEXISTING CONSTRUCTION TO BE REMOVEDREMOVAL KEYNOTE -SEE REMOVAL KEYNOTE DESCRIPTIONSHARD-WIRED, INTERCONNECTED SMOKE DETECTOR/ALARMCONTRACT/CONSTRUCTION LIMIT LINE (CLL)CLLELECTRICAL PANEL (POWER/LIGHTING)P1DUPLEX OUTLETGROUND FAULT CIRCUIT INTERRUPTER OUTLET101AW16DCBA354321654321REVISIONS:Architects, P.C.Designed By:CHARETTE ASSOCIATESNotice:The drawings, plans, specifications and designs contained herein are and shall remain the exclusive property of Charette Associates Architects, P.C., and cannot be altered, copied, duplicated or used directly or indirectly in whole or in part except with the express written permission of Charette Associates Architects, P.C. Copyright 2023PROJECTDESIGNEDDRAWNDRAWING TITLESEALCHECKEDAPPROVEDDATEPROJECT NO.SCALEDRAWING NO.Gansevoort, New YorkPhone (518) 265-2628 Fax (518) 581-05301/4" = 1'-0"RENOVATE APARTMENT #9282 Ballston AvenueSaratoga Springs, NY 12866REMOVAL PLANSAD-1012301LALALAJK/AK12/28/23SCALE:1/4" = 1'-0"BASEMENT REMOVALSC1SCALE:1/4" = 1'-0"FIRST FLOOR REMOVALSA1REMOVAL KEYNOTESD1 REMOVE EXISTING PARTITION WHERE INDICATED.D2 REMOVE DOOR ,FRAME AND TRIM.D3 REMOVE WINDOW, FRAME AND TRIM.D4 EXCAVATE AS REQUIRED FOR INSTALLATION OF EGRESS WINDOWWELL.D5 REMOVE GWB CEILING AND ALL CEILING MOUNTED LIGHT FIXTURESAND EXHAUST FANS.D6 REMOVE STAIRS, RAILINGS AND LANDING. REMOVE ALL EXISTINGFRAMING UNDER LANDING.D7 REMOVE ACT CEILING AND SUSPENSION GRID. REMOVE CEILINGMOUNTED LIGHT FIXTURES.D8 SAWCUT AND REMOVE EXISTING FOUNDATION WALL AS REQUIREDFOR NEW OPENING.D9 REMOVE DOOR AND RE-INSTALL HARDWARE AND FRAME ASREQUIRED TO CHANGE DOOR SWING.D10 REMOVE AND SALVAGE DOOR AND FRAME FOR RE-INSTALLATIONWHERE INDICATED IN THE PLANS. REPLACE DOOR WITH SIMILAR IF ITCANNOT BE PROPERLY RE-INSTALLED IN NEW CONFIGURATION.D11 REMOVE ELECTRICAL OUTLET/SWITCH.D12 REMOVE ELECTRIC BASEBOARD.D13 REMOVE THERMOSTAT.D14 REMOVE SMOKE DETECTOR.D15 REMOVE PRECAST CONCRETE STEPS AND RELOCATE WHEREINDICATED IN PLANS. DNDNDNDNSDWUPGFCIGFCIGFCIGFCIT 33STTSSGFCI5' - 10"F/ FDN3' - 6"R @7 5/8"83' - 0"WOOD LEDGE @ 36" A.F.F.SUNROOM9-12SUNROOM9-13BILCO SCAPEWELL 4048-42 EGRESS WINDOW WELL W/ COVER (TYP OF 3)SPLIT-SYSTEM COMPRESSOR -LOCATE IN FIELDEXIST'G FENCEAPARTMENT #8APARTMENT #7APARTMENT #6A1A-501REMOVE DOOR AND RE-INSTALL AS CONFIGURED TO SWING INTO ROOM #9-12RELOCATE EXISTING STEPS TO OPPOSITE SIDE OF DOORBILCO SCAPEWELL 4048-66 EGRESS WINDOW WELL W/ COVER (TYP OF 1)REMOVE AND REPLACE SLIDING DOOR WITH SAME SIZED UNIT WITH SLIDING PANEL IN OPPOSITE SIDEOPEN36" HIGH WOOD HANDRAIL WITH 12" EXTENSIONS TOP AND BOTTOMREPLACE LANDING -SEEFOR FRAMING/A5A-101BEDROOM9-11GREATROOM9-03WALK-IN9-09BASEMENT6-01BATHROOM9-07CLOSET9-10CLOSET9-04ENTRY9-01CLOSET9-05HALL9-08BASEMENT9-06KITCHEN9-02P1P1P13' - 7"5' - 10"3' - 6 1/2"BILCO SCAPEWELL 4048-42 EGRESS WINDOW WELL W/ COVER (TYP OF 3)F1W4SPLIT SYSTEM MULTI-ZONE WALL DIFUSERS (TYP OF 2)A1A-501W1REPLACE ALL CEILINGS W/ 1 HR CONSTRUCTION -SEE /B5A-101RELOCATE SWITCHESW3W2W4W4DBLE 2X10 HDRDBLE 2X10 HDRDBLE 2X10 HDRDBLE 2X10 HDREXIST'G SUMP PITEXISTING ELECTRICAL PANELBILCO SCAPEWELL 4048-66 EGRESS WINDOW WELL W/ COVER (TYP OF 3)P2RELOCATE EXISTING DOORTHERMOSTAT (TYP OF 3)P1P1P1P12' - 10"2' - 0"SET WINDOW AT EXISTING RIGHT JAMB2' - 0"2' - 11"FFIRE-RATED BATHROOM EXHAUST FAN VENTED TO EXTERIOR -AIR KING MODEL FRAS50 OR EQUALWIRE SHELVING AND RODS (TYP)@2x8 JOISTS16" O.C.2x8 LEDGER(2) 2X8 HEADER2x8 LEDGERLAG BOLT LEDGERS TO FDN WALL W/ 1/2" LAGS @ 16" O.C. STAGGEREDPLAN SYMBOL LEGENDCHARD-WIRED, INTERCONNECTED COMBINATION SMOKE DETECTOR/CARBON MONIXIDE DETECTOR Room101DOORNEW WALL & TYPE SYMBOL -SEE WALL TYPE SCHEDULEROOM NAME & NUMBER -SEE FINISH SCHEDULEWINDOW W1?D1EXISTING CONSTRUCTION TO REMAINEXISTING CONSTRUCTION TO BE REMOVEDREMOVAL KEYNOTE -SEE REMOVAL KEYNOTE DESCRIPTIONSHARD-WIRED, INTERCONNECTED SMOKE DETECTOR/ALARMCONTRACT/CONSTRUCTION LIMIT LINE (CLL)CLLELECTRICAL PANEL (POWER/LIGHTING)P1DUPLEX OUTLETGROUND FAULT CIRCUIT INTERRUPTER OUTLET101AW16DCBA354321654321REVISIONS:Architects, P.C.Designed By:CHARETTE ASSOCIATESNotice:The drawings, plans, specifications and designs contained herein are and shall remain the exclusive property of Charette Associates Architects, P.C., and cannot be altered, copied, duplicated or used directly or indirectly in whole or in part except with the express written permission of Charette Associates Architects, P.C. Copyright 2023PROJECTDESIGNEDDRAWNDRAWING TITLESEALCHECKEDAPPROVEDDATEPROJECT NO.SCALEDRAWING NO.Gansevoort, New YorkPhone (518) 265-2628 Fax (518) 581-0530As indicatedRENOVATE APARTMENT #9282 Ballston AvenueSaratoga Springs, NY 12866FLOOR PLANSA-1012301LALALAJK/AK12/28/23SCALE:1/4" = 1'-0"FIRST FLOOR PLANA1SCALE:1/4" = 1'-0"BASEMENT PLANC1FINISH SCHEDULENO.NAMEFLOORBASEWALLCEILINGREMARKSMATL FIN MATL FIN MATL FIN MATL FIN6-01 BASEMENT EX - - - EX/CMU - - -9-01 ENTRYEX - WD PT GWB PT EX -9-02 KITCHENEX - EX - EX - GWB PT9-03 GREAT ROOM EX/LVP - EX - EX/GWB PT GWB PT PATCH WALLS & FLOORS TO MATCH EXIST'GADJACENT CONSTRUCTION9-04 CLOSETEX - EX - EX - GWB PT9-05 CLOSETEX - EX - EX - GWB PT9-06 BASEMENT EX - - - EX/CMU - - -9-07 BATHROOM EX - EX - EX - GWB PT9-08 HALLEX - EX - EX - GWB PT9-09 WALK-INEX - EX - EX PT GWB PT PATCH WALLS & FLOORS TO MATCH EXIST'GADJACENT CONSTRUCTION9-10 CLOSETEX - EX - EX - GWB PT9-11BEDROOM EX - EX - EX/GWB PT GWB PT9-12SUNROOM EX - EX - EX - EX -9-13SUNROOM EX - EX - EX - EX -SCALE:1 1/2" = 1'-0"FLOOR CEILING DETAILB5WINDOW SCHEDULEMARKSIZEMANUFACTURER MODEL MATGLAZINGLIGHT VENT EGRESS COMMENTSWIDTH HEIGHTTHICK TYPEW1 5' - 3" 2' - 10" -EXISTING SLIDER - - - 8.33 SF 4.16 SF NO EXISTING TO REMAINW2 5' - 10" 2' - 0" -EXISTING SLIDER - - - 11.66 SF 5.83 SF NO EXISTING TO REMAINW3 4' - 8 1/2" 3' - 4 13/16" ANDERSEN CORP. 400-SERIESCASEMENTFIBREX 1" LOW 'E' 12.0 SF 11.1 SF YESW4 2' - 11 15/16" 3' - 4 13/16" ANDERSEN CORP. 400-SERIESCASEMENTFIBREX 1" LOW 'E' 7.9 SF 7.0 SF YESWALL SCHEDULEMARK DESCRIPTIONF18" CMU INFILL CONSTRUCTION w/ 2x FURRED WALL w/ 1/2" GWB TO MATCH EXIST'G ADJACENT CONSTRUCTION.P12x4 WOOD STUDS @ 16" O.C. w/ 1/2" GWB TAPED & PAINTED ON ONE SIDE.P22x4 WOOD STUDS @ 16" O.C. w/ 1/2" GWB TAPED & PAINTED ON EACH SIDE.SCALE:1/2" = 1'-0"LANDING FRAMING PLANA5 GFCIHANDRAIL-EXTEND 12" MIN PAST TOP/BOTTOM RISER (TYP)PROVIDE MIN. 36" CLEAR WIDTH AT STAIRWAYS AND LANDINGSOAK BULLNOSE TREADS SCREWED AND GLUEDOAK RISERS(3) 2x12 STRINGERS6'-8" MIN. HEADROOMMINIMUM REQUIREMENTSBALUSTER SPACING (CLEAR) 4" MAX.CLEARANCE ABOVE NOSING 6'-8" MIN.LANDING LENGTH & WIDTH EQUAL TO STAIR WIDTHLANDING RAILING 42" ABOVE LANDINGNOSING 1 1/8"RISE 8" MAXIMUMSTAIR RAILING 30" TO 34" ABOVE NOSINGTREAD 9" MINIMUMWIDTH OF STAIRS 36" MINIMUM.STAIR DETAIL2 1/8"Basement-8' -2 1/2"Grade-2' -10 1/2"TIE ROCK FILL INTO TO EXISTING FOUNDATION DRAINAGE SYSTEM. WRAP DRAIN WITH GEO-FABRIC12" MIN WIDTH 3/4" CLEAN FREE-DRAINING ROCK OR A6 STONE BACKFILL AROUND ALL SIDES OF WELL. FILL TO DEPTH OF FOUNDATION FOOTINGPITCH SOIL 1" PER FOOT FOR DRAINAGEBILCO DOME COVER MODEL 4042C OR 4066CEGRESS WINDOW -SEE PLANS FOR SIZE NOTE THAT WINDOW SHALL FULLY OPEN WITHOUT OBSTRUCTIONEXISTING FOUNDATION WALLREMOVE FOUNDATION CONSTRUCTION AS REQUIRED FOR WINDOW INSTALLATION6" TOPSOILMIN. 3 1/2"BILCO SCAPEWELL MODEL 4048-42 OR 4048-66 (PER PLANS)EDGE OF WELL SIDE PANEL44" MAX. TO SILLV.I.F.1' - 9"V.I.F.2' - 3"CLEAR30"41"MAX BELOW GRADE20"EXISTING FINISHED FLOOR -BASEMENTEXISTING FINISHED FLOOR -FIRST FLOORDOUBLE 2X10 HEADEREXIST'G 2X10 FLOOR JOISTS @ 16" OC5/8" UL TYPE C, OR ULIX, FIRERATED GWB1/2" 25 GA. RESILIENT CHANNELS @ 16" O.C.3-1/2" GLASS FIBER BATT INSULEGRESS WINDOW WELL SPECIFICATIONS:MANUFACTURER:BILCOMODEL:SCAPEWELL 4048-42 W/ 4042C DOME COVERSCAPEWELL 4048-66 HEIGHT:48" PROJECTION FROM FOUNDATION:41" DISTANCE FROM FDN TO 1ST STEP:30"INTERIOR WIDTH:42" (SCAPEWELL 4048-42) 66" (SCAPEWELL 4048-66)NOTES:INSTALLATION TO BE COMPLETED IN ACCORDANCE WITH MANUFACTURER'S SPECIFICATIONS.TOP VIEWFRONT VIEW3' - 5"SEE PLANS3'-6" (SCAPEWELL #4048-42)5' - 6" (SCAPEWELL #4048-66)EQEQ2' - 6"8"INTERIOR FACE OF TIERED STEP PANELS (TYP OF 2)EGRESS WINDOWFOUNDATION WALLPARGE EXPOSED BELOW GRADE FOUNDATION WALLSIDE PANELS3'-6" (SCAPEWELL #4048-42)5' - 6" (SCAPEWELL #4048-66)4' - 0"2' - 0"2' - 0"(2) TIERED STEPSSIDE PANELS TOP OF STEP PANELSGRADEMIN.4"MIN.3 1/2"WINDOW BEYONDWINDOW SILL @ 44" A.F.F. MAX.BOTTOM OF WELLPLAN SYMBOL LEGENDCHARD-WIRED, INTERCONNECTED COMBINATION SMOKE DETECTOR/CARBON MONIXIDE DETECTOR Room101DOORNEW WALL & TYPE SYMBOL -SEE WALL TYPE SCHEDULEROOM NAME & NUMBER -SEE FINISH SCHEDULEWINDOW W1?D1EXISTING CONSTRUCTION TO REMAINEXISTING CONSTRUCTION TO BE REMOVEDREMOVAL KEYNOTE -SEE REMOVAL KEYNOTE DESCRIPTIONSHARD-WIRED, INTERCONNECTED SMOKE DETECTOR/ALARMCONTRACT/CONSTRUCTION LIMIT LINE (CLL)CLLELECTRICAL PANEL (POWER/LIGHTING)P1DUPLEX OUTLETGROUND FAULT CIRCUIT INTERRUPTER OUTLET101AW1RAILING ELEVATIONTYPICAL (FOLLOW RAKE OF STAIRS/LEVEL AT LANDINGS)2' - 10"6"1' - 0"TOP OF LANDINGPROVIDE LEVEL HANDRAIL EXTENSION AT TOP & BOTTOM OF RUN, TYPICALPROVIDE CONTINUOUS PAINTED, 1 1/2" DIA. STEEL PIPE HANDRAILPROVIDE PAINTED STEEL HANDRAIL BRACKETS, BOLTED TO WALL W/ 3/8" DIA. X 3" GALVANIZED STEEL EPOXY ANCHOR BOLTS, W/WASHERS (PAINTED). PROVIDE BLOCKING IN WALL (TYPICAL)WALL BEYOND6DCBA354321654321REVISIONS:Architects, P.C.Designed By:CHARETTE ASSOCIATESNotice:The drawings, plans, specifications and designs contained herein are and shall remain the exclusive property of Charette Associates Architects, P.C., and cannot be altered, copied, duplicated or used directly or indirectly in whole or in part except with the express written permission of Charette Associates Architects, P.C. Copyright 2023PROJECTDESIGNEDDRAWNDRAWING TITLESEALCHECKEDAPPROVEDDATEPROJECT NO.SCALEDRAWING NO.Gansevoort, New YorkPhone (518) 265-2628 Fax (518) 581-0530As indicatedRENOVATE APARTMENT #9282 Ballston AvenueSaratoga Springs, NY 12866DETAILSA-5012301LALALAJK/AK12/28/23SCALE:3/4" = 1'-0"STAIR DETAILC1SCALE:3/4" = 1'-0"EGRESS WINDOW WELL -EXTERIORA1SCALE:1/2" = 1'-0"EGRESS WINDOW WELL DETAILA4 SECTION 01000 -PROJECT REQUIREMENTSSummary:1. The Project consists of: a. Removal of existing ceiling in Apartment #9 and replacement with 1-hour rated construction.b. Replacement of the existing wood stair in Apartment #9.c. Installation of egress windows and associated egress window wells in Apartment #9.d. Updates to the fire alarm and detection system.e. Electrical updates as required for the building to comply with the NEC.f. Floor plan modifications within Apartment #9 as indicated in the drawings.g. Installation of Split-System HVAC units in Apartment #9.Project Requirements:1. The building may be occupied during the performance of construction work.2. Existing Site Conditions and Restrictions: Contractor shall protect the work areas at all times during the work.3. Contractor shall protect tenants and their property from the Contractor's performance of the work.4. Contractor's Use of Premises and Adjacent Facilities: Contractor may use water, sewer, power and toilet facilities in Apartment #9 as required.Permits:1. Apply for, obtain, and pay for building permits, other permits, and utility company backcharges required to perform the work. Submit copies to Owner.Intent:1. Drawings and specifications are intended to provide the basis for the proper completion of the Project suitable for the intended use of the Owner.2. Items not expressly set forth but which are reasonably implied or necessary for the proper performance of this work shall be included.Coordination:1. Coordinate the work of all trades. 2. Prepare coordination drawings for areas above ceilings where close tolerances are required between building elements and mechanical and electrical work.3. Verify location of utilities and existing conditions. Notify Architect of conditions differing from those indicated on the Drawings.4. Verify dimensions on Drawings with dimensions at the Project. Do not scale Drawings.Cutting and Patching:1. Provide cutting and patching work to properly complete the Project.2. Do not remove or alter structural components without written approval.3. Cut with tools appropriate for materials to be cut.4. Patch with materials and methods to produce patch which is not visible from a distance of five feet.5. Do not cut and patch in a manner that would result in a failure of the work to perform as intended, decrease fire performance, decrease acoustical performance, decrease energy performance, decrease operational life, or decrease safety factors.Field Engineering:1. Verify and locate utilities, existing facilities, and equipment.2. Survey and layout improvements, utilities, structures, and components.Submittals:1. Submit a project schedule and update at least monthly. Submit for approval all submittals listed in individual sections with the following number of copies: Shop drawings, reviewed and annotated by the Contractor, 3 copies; product data, 3 copies; samples, 3 sets plus range samples where applicable; test reports, 3 copies; warranties, 3 copies; other submittals, 3 copies. Upon approval by the Architect, shop drawings may be submitted electronically in pdf format.2. Include details of construction and adjacent construction in shop drawings. Clearly indicate any deviations from requirements of the contract documents. Fabricate materials from approved shop drawings only.Quality Assurance:1. Comply with applicable codes, regulations, ordinances and requirements of authorities having jurisdiction, including accessibility guidelines where applicable. Submit copies of inspection reports, notices and similar documents to Architect.2. Provide products of acceptable manufacturers which have been in satisfactory use in similar service for three years.3. Use experienced installers. Furnish evidence of experience if requested.4. Deliver, handle, and store materials in strict accordance with manufacturer's instructions.5. Use of any supplier or subcontractor is subject to Owner's approval.6. Engage and pay for testing agencies as required. Refer to individual sections for additional requirements.Temporary Facilities:1. Provide temporary facilities and connections as required for the proper completion of the project. 2. Provide and maintain temporary utility services. 3. Owner will pay for utility service consumed. Do not waste.4. Provide temporary protection for adjacent areas to prevent contamination by construction dust and debris.5. Provide temporary barricades as necessary to ensure protection of the public.6. Provide suitable waste disposal units and empty regularly. Do not permit accumulation of trash and waste materials.7. Use of designated existing sanitary facilities in building is acceptable.8. Maintain egress within and around construction areas.9. Maintain fire alarm systems in operation during construction.10. Provide fire extinguishers in work areas during construction.11. Provide temporary protection for adjacent construction. Promptly repair any damage at no additional cost to the Owner.Products and Substitutions:1. Provide products and materials specified. Request Architect's selection of colors and accessories in sufficient time to avoid delaying progress of the work.2. Submit requests for substitutions shall be in writing, including reasons. Submit sufficient information for Architect to evaluate proposed substitution. 3. Remove and replace work which does not conform to the contract documents at no additional expense to the Owner.Installation:1. Inspect substrates and report unsatisfactory conditions in writing.2. Do not proceed until unsatisfactory conditions have been corrected.3. Take field measurements prior to fabrication where practical. Form to required shapes and sizes with true edges, lines and angles. Provide inserts and templates as needed for work of other trades.4. Install materials in exact accordance with manufacturer's instructions and approved submittals. 5. Install materials in proper relation with adjacent construction and with proper appearance.6. Restore units damaged during installation. Replace units which cannot be restored at no additional expense to the Owner.7. Refer to additional installation requirements and tolerances specified under individual specification sections.Closeout:1. Prepare punchlist for remaining work for review by the Architect. 2. Complete punchlist items promptly at no additional expense to the Owner.3. Submit accurate record documents of building and site.4. Submit operating manuals, maintenance manuals, and warranty information.5. Obtain and submit copy of occupancy permits.6. Train Owner in use of building systems.7. Remove temporary facilities and provide final cleaning and touch-up.8. Restore portions of building, site improvements, landscaping and other items damaged by construction operations to the satisfaction of the Architect at no additional expense to the Owner.SECTION 02220 -DEMOLITIONSummary:1. Provide selective demolition of interior partitions, systems, and building components designated to be removed.2. Protect portions of building, site and adjacent structures affected by demolition operations.3. Remove hollow items or items which could collapse.4. Remove abandoned utilities and wiring systems.5. Notify Owner of schedule of shut-off of utilities which serve occupied spaces.6. Provide temporary protection for the public from demolition operations.7. Provide pollution control during demolition operations.8. Provide removal and legal disposal of materials.Demolition:1. Survey existing conditions and correlate with Drawings and specifications to verify extent of demolition required.2. Verify conditions at site to determine whether demolition methods proposed for use will not endanger existing structures by overloading, failure, or unplanned collapse.3. Perform demolition operations by methods which do not endanger adjacent spaces, structures, or the public.4. Perform demolition operations to prevent dust and pollutant hazards. Provide chutes as required to control dust and debris.SECTION 05500 -METAL FABRICATIONSSummary:1. Provide metal fabrications:a. Railings and Handrails.2. Tolerances: Fabrication tolerance 1/8 inch in 10 feet; erection tolerance, 1/16 inch.Submittals:1. Submit product data, shop drawings.Products:1. Steel Plates, Shapes and Bars: ASTM A 36.2. Aluminum Extruded Bars and Shapes: ASTM B 221 aluminum alloy.3. Steel Finish: Primed4. Fasteners: non-corrosive, suitable for service intended.5. Zinc-Coating: Hot-dip galvanized coating for materials in exterior assemblies or exterior walls.6. Aluminum Finish: Color anodizedInstallation:1. Comply with requirements of Section 01000 -Project Requirements.2. Comply with ASTM E 985 for handrail and railing structural performance.Comply with AISC codes and specifications and with AWS Structural Welding Code.SECTION 06100 -ROUGH CARPENTRYSummary:1. Provide Rough Carpentry:a. Framing with dimension lumber.b. Wood grounds, nailers, and blocking.c. Remodel existing rough carpentry.Products:1. Lumber Standards and Grade Stamps: PS 20, American Softwood Lumber Standard and inspection agency grade stamps.2. Construction Panel Standards: PS 1, U.S. Product Standard for Construction and Industrial Plywood; APA PRP-108.3. Wood Framing Standards: NFPA House Framing Manual.a. Interior Wall Framing: 2 inch by 4 (or 6) inch studs, 16 inches on center.4. Preservative Treatment: AWPA C2 for lumber and AWPA C9 for plywood; waterborne pressure treatment.a. Preservative retention 0.25 pcf.5. Fire-Retardant Treatment: AWPA C20 for lumber and AWPA C27 for plywood; noncorrosive type.6. Dimension Lumber:a. Light Framing: Stud, No. 2 or Standard grade.b. Structural Framing: No. 1 grade.c. Species: Spruce, Pine, Fir.7. Boards:a. Exposed Boards: 15 percent moisture content.b. Concealed Boards: 19 percent moisture content.8. Miscellaneous Lumber, Blocking and Nailers:a. Moisture Content: 19 percent.b. Grade: Standard grade light framing.9. Auxiliary Materials:a. Framing Anchors and Fasteners: Non-corrosive, suitable for load and exposure.Installation:1. Comply with requirements of Section 01000 -Project Requirements.2. Comply with NFPA Manual for House Framing, NFPA Recommended Nailing Schedule, and NFPA National Design Specifications for Wood Construction.3. Comply with APA Design and Construction Guide, Residential and Commercial Construction.4. Provide nailers, blocking and grounds where required. Set work plumb, level and accurately cut.5. Comply with manufacturer's requirements for treated materials.SECTION 07270 -FIRESTOPPINGSummary:1. Provide Firestopping at the Following Locations:a. Penetrations through fire-resistance-rated floor construction.b. Penetrations through fire-resistance-rated walls and partitions.c. Penetrations through smoke barriers and construction enclosing compartmentalized areas.d. Sealant joints in fire-resistance-rated construction.Products:1. Fire Performance: ASTM E 119, ASTM E 814, and local regulations.2. Through-Penetration Firestop Systems:a. Endothermic, Latex Compounds.b. Intumescent Latex Sealant.3. Fire-Resistive Elastomeric Joint Sealants:a. Single-component, neutral-curing, silicone sealant.Installation:1. Comply with requirements of Section 01000 -Project Requirements.2. Inspect existing and new work for proper firestopping prior to close-in of ceilings and walls.3. Provide material thicknesses necessary to provide fire-resistance ratings indicated or required by authorities having jurisdiction.SECTION 07900 -JOINT SEALERSSummary:1. Provide joint sealers at interior and exterior vertical and horizontal joints.Products:1. Urethane Elastomeric Joint Sealants:a. Nonsag Type and Application: One-part nonsag urethane sealant, ASTM C 920, for vertical and horizontal joints, exterior and interior use.2. Silicone Elastomeric Joint Sealants:a. Type and Application: One-part nonacid-curing silicone sealant, ASTM C 920, for vertical and horizontal joints, modulus as required for application, exterior and interior use.b. Type and Application: One-part mildew-resistant silicone sealant, ASTM C 920, for sanitary applications, interior use.3. Polysulfide Elastomeric Joint Sealants:a. Nonsag Type and Application: Two-part nonsag polysulfide sealant, ASTM C 920, for vertical joints, exterior and interior use.4. Latex Joint Sealants:a. Silicone Type: Silicone emulsion, ASTM C 834, and ASTM C 920.b. Application: Interior joints in vertical and overhead surfaces with limited movement.5. Compression Seals:a. Type: Preformed foam sealant.b. Application: Wide exterior joints in vertical surfaces.6. Fire-Resistive Joint Sealers:a. Type: One part fire-stopping sealant.b. Application: Penetrations in fire-rated floor and wall assemblies.7. Specialty Sealants:a. Type and Application: Butyl-polyisobutylene sealant and tape sealant for concealed joints.8. Auxiliary Materials:a. Plastic foam joint fillers.b. Elastomeric tubing backer rods.c. Bond breaker tape.Installation:1. Comply with requirements of Section 01000 -Project Requirements.2. Test sealant adhesion for each substrate required.3. Install in proper relation with adjacent work.4. Clean adjacent surfaces soiled with sealant immediately.SECTION 09260 -GYPSUM BOARD ASSEMBLIESSummary:1. Provide Gypsum Board Assemblies:a. Interior ceilings for tape and joint compound finish.2. Gypsum Board Attachment:a. Gypsum board nail-attached to wood framing and metal furring.Products:1. Products: As selected by Architect complying with the following.2. Gypsum Board:a. Gypsum Wallboard: ASTM C 36, regular, foil-backed, and fire-rated types:1. 5/8 inch typical thickness.b. Joint Treatment: ASTM C 475 and ASTM C 840, 3-coat system.c. Installation Standard: ASTM C 840.3. Trim Accessories:a. Material: Metal.b. Types: Cornerbead, edge trim, and control joints.4. Auxiliary Materials:a. Gypsum board screws, ASTM C 1002.b. Gypsum board nails, ASTM C 514.c. Fastening adhesive.Installation:1. Comply with requirements of Section 01000 -Project Requirements.2. Comply with standards referenced above and ASTM C 840 and GA 216.3. Install joints only over framing members. Do not allow butt-to-butt joints.4. Provide blocking for items such as railings, grab bars, casework, toilet accessories, and similar items.5. Install gypsum board assemblies true, plumb, level and in proper relation to adjacent surfaces.6. Where new partitions meet existing construction, remove existing cornerbeads to provide smooth transition.7. Provide 3-coat joint treatment such that, after finishing, joints are not visible.a. Sand and leave ready for finish painting and wall treatmentsSECTION 09910 -PAINTINGSummary:1. Provide painting and surface preparation for interior unfinished surfaces as scheduled.2. Provide repainting and surface preparation at areas of remodeling.3. Provide painting of entire surface where patch painting is required.Products:1. Products: Benjamin Moore or Sherwin Williams.2. Regulations: Compliance with VOC and environmental regulations.3. First-line commercial-quality products for all coating systems.Installation:1. Comply with requirements of Section 01000 -Project Requirements.2. Provide field-applied mock-ups of each color and finish selected on actual surfaces to be painted.3. Test sample area for adhesion for each type of paint.4. Remove cover plates and protect hardware and adjacent surfaces.5. Sand before painting until smooth and flat and sand between coats.6. Apply paint to achieve manufacturer's recommended dry film thicknesses.7. Paint entire surface where patch painting is required.8. Recoat areas which show bleed-through or defects.9. Clean paint spatter from adjacent surfaces and glass. 10. Touch-up damaged surfaces at completion of construction.SECTION 15500 -HEATING AND VENTILATINGSummary:1. Provide Split System HVAC System in Kitchen.2. Provide equipment, systems, and controls for heating, ventilation, and central air conditioning.3. Coordinate with Owner's room uses to provide adequate system for all contract areas.4. Coordinate location of thermostats and controls with Owner’s requirements.5. Coordinate location of ductwork & piping to avoid interference with location of designated lighting fixture locations.6. Do not cut structural elements without prior written approval.Design Conditions:1. Systems: Split System HVAC.2. Utility Service: Gas.3. Provide systems designed to ASHRAE weather data using mean coincident wet-bulb climatic conditions and the following:a. Winter Dry Bulb: 99 percent.Quality Assurance:1. Installer Qualifications: Company specializing in performing work of the type specified in this section, with minimum 5 years of experience.2. Provide all grooved joint couplings, fittings, valves, specialties, and grooving tools from a single manufacturer.Products:1. Provide new materials suitable for service intended complying with approved shop drawings. Provide accessory items such as controls, anchors and insulation.Installation:1. Comply with requirements of Section 01000 -Project Requirements.2. Comply with applicable codes, regulations, ordinances and requirements of authorities having jurisdiction.3. Conceal piping to the greatest extent practical.4. Maintain indicated fire ratings of walls, partitions, ceilings, and floors at penetrations. Seal with firestopping to maintain fire rating.5. Install in accordance with manufacturer's instructions.6. Install piping to conserve building space and to avoid interfere with use of space.7. Group piping whenever practical at common elevations.8. Sleeve pipe passing through partitions, walls and floors.9. Slope piping and arrange to drain at low points.10. Insulate piping and ductwork. Provide vapor barrier on insulated piping operating below 60 degrees F.11. Test all systems for proper operation.12. Instruct Owner's personnel in proper operation of systems.SECTION 16000 -ELECTRICALSummary:1. Provide electrical systems for the following:a. Power.b. Lighting.c. Fire Alarm and Detection Systems2. Modify, relocate and extend existing service to accommodate new work.3. Maintain fire alarm system in operation during construction.4. Coordinate with Owner's room uses to provide adequate system for all contract areas.5. Do not cut structural elements without prior written approval.Products:1. Provide new materials suitable for service intended complying with approved submittals. Provide accessories such as controls, cover plates, and connections to equipment. Finish as selected by Owner.2. Provide flush-mounted or wall-mounted ceiling fixtures.3. Recessed ceiling lights and exhaust fans must be fire-rated fixtures.4. Smoke and carbon monoxide detectors and alarms shall be hard-wired and interconnected.Installation:1. Comply with requirements of Section 01000 -Project Requirements.2. Comply with applicable codes, regulations, ordinances and requirements of authorities having jurisdiction and National Electrical Code.3. Provide core drilling as required for new work.4. Conceal conduit to the greatest extent practical.5. Install light switches at uniform height above finished floor. Locate switches within rooms at strike side of door unless noted otherwise.6. Install thermostats centered above light switches where applicable.7. Gang-mount multiple switching locations. Mount multiple types of controls as close together as possible and in-line with each other at uniform height above finished floor unless noted otherwise.8. Group multiple junction boxes, telephone and electrical outlets together on walls. Avoid back-to-back box locations.9. Mount electrical outlets vertically, at uniform height above finished floor unless noted otherwise.10. Maintain indicated fire ratings of walls, partitions, ceilings, and floors at penetrations. Seal with firestopping to maintain fire rating.11. Test all systems for proper operation.12. Label circuits in electrical panels.13. Instruct Owner's personnel in proper operation of systems.DESIGN CRITERIA:Per BCNYS Tables 1604.3 & 1607.1 Loads DeflectionLocationLiveDeadLimits 1st Floor (non-Public Rooms)40 psf15 psfL/3602nd Floor (non-Public Rooms)40 psf15 psfL/360WOODMATERIALS:1. All woods and wood construction shall comply with specifications and codes with modifications as specified herein:a.American Institute of Timber Construction (Standards Manual).b.National Forest Products Association: National Design specifications for Wood Construction.c.Southern Pine Inspection Bureau: Standard grading rules for Southern Pine Lumber).d.Truss Plate Institute: Design specifications for Light Metal plate Connected Wood Trusses (TPI-71).e.U.S. Department of Commerce N.IS.T. PS-1 & PS-2f.American Plywood Association: Guide to plywood for floors, plywood sheathings for walls and roofs.g.American Wood-Preservers Association Standards.1. All structural lumber shall be Spruce Pine Fir #2 (minimum) stress grade lumber unless otherwise noted.*Fb = 950 psi; Fv = 135 psi; E = 1,300,000 psi (NDS Supplement: Design Values Wood Construction-2001 edition)*Repetitive member value may vary due to member size per National Forest Products Association specifications.1. All structural lumber shall be stamped in accordance with the American Institute of Timber Construction’s “Construction Manual”.2. Grade loss resulting from effects of weathering, handling, storage, resawing or dividing lengths will be cause for rejection.3. All plywood shall be identified by grade mark of an appropriate inspection agency and shall be Standard C-D, Flat Interior with ext. glue unless otherwise specified on drawings.4. Wood structural panels shall conform to the requirements of DOC PS-1 & PS-2 and be identified by a grade mark of an approved inspection agency.5. Wood which is in contact with concrete, masonry, soil or within 1’-0”of grade or exposed to the exterior shall be pressure preservative treated.6. Locate double floor joist under all interior partitions running parallel to framing under plumbing fixtures and at floor openings. Provide 1 x 3 mid-span cross bridging at all floor joist and spans.CONNECTIONS:Nailing:Minimum nailing requirements for standard connections unless specifically shown or noted otherwise.ITEM No. or o/cSize of NailsJoint Toe nail to plates, sill or girder38d To parallel alternate joints316d At laps overbearing, face nail316dStuds End nail to plates216d Or toe nail to each side48dTop Plates Spike together16”o/c16d Laps & intersections, face nail216dBlocking To plate216d or toe nail48d Toe joist each side216d or toe nail 48dBridging Toe nail to joists, each end28dStuds Corner, angle or multiple24”o/c16d2”x laminated beams or lintels spike together16”o/c16dDouble joists or headers Spike together, along each edge16”o/c16dPlywood sheathing and sub-floor Nailing at edges of each sheet 3/8”thick6”o/c8d ½”& 5/8”thick 6”o/c10d At interior of each sheet space nails 10”o/c for 3/8”and ½”thick plywood.1. Sheathing shall be nailed as follows, except where shown otherwise:a. Floor sheathing: 8d common at 6”o/c at all supported edges and at 10”o/c at interior supports.b. Nail wood sheathing direct to framing: 10d common at 6”o/c all panel edges and at 10”o/c at all interior studs.2. All manufactured connection hardware designated on Drawings shall be nailed in strict conformance to manufacturer’s instructions.3. All steel connections assemblies detailed on Drawings shall be fabricated from ASTM A36 steel in conformance to manufacturer’s instructions.4. Install lag screws in drilled lead holes with a diameter equal to ¾ of the shank diameter (lag screws shall not be hammered in). Wax or soap lag screws. Provide washers under heads bearing on wood. Holes shall be properly aligned.5. Bolt holes shall be drilled 1/16”larger than bolt diameter. Provide washers under all bolt heads and nuts bearing on wood. Holes shall be properly aligned.6. In no case shall misalignment be allowed which prevents proper bearing or alignment of members. Oversize holes shall not be allowed. Bolts shall be ASTM A307 bolts. Nuts shall be tightened snug.INSTALLATIONS:1. Beams, girders and joists supporting bearing walls or other concentrated loads, shall not be notched unless specified. Joists, except as above, may be notched no deeper than 1/6 the depth provided such notch is located within 1/3 of span from face to support. Saw cuts for notches shall not overrun depth of notch. Holes in joists, beams, and girders shall not be larger in diameter than 1/3 the depth of member and shall be located within center half of the span. All holes shall be centered within depth of member with a minimum of 2”lumber remaining above and below drill hole. Holes and notches in studs shall be located within 1/3 of height from either top or bottom, but no closer than 8”form plates. Holes and notches in studs shall not exceed ¼ of the stud width. Holes bored through studs may not exceed 40% of stud width and be no closer than 5/8”to edge of stud. 2. Joists and decking shall not be cut and headed or displaced to provide for openings in floors, except as detailed on Drawings.3. Install all horizontal members with crown up. All beam and joist intersections to receive galvanized joist/beam hangers.4. All members in bearing shall be accurately cut and aligned so that full bearing is provided without use of shims. Bearing posts shall have full blocking or support under.5. All joists shall have a minimum of 2”bearing at supports unless otherwise specified.6. Plywood sub-floor: Install with face grain at right angles to supports, continuous over two (2) or more spans. Allow minimum space 1/16”between end joists and 1/8”at edge joints for expansion and contraction of panels. Plywood decking shall also be continuously glued and nailed to all joists, rafters or trusses.7. All wood framing in contact with concrete or masonry shall be pressure treated.8. Finishes shall be installed in accordance with manufacturer’s requirements. Prepare all substrates as required by manufacturer.STRUCTURAL MATERIAL SPECIFICATIONS:Structural Steel………………………………ASTM A-36, Fy = 36 ksiLumber…………………..…………………………No. 2 SPF = 950 psi (min. repetitive member use) E = 1.2 x 106 psiWood Structure Panels…..……………DOC PSI, DOC PS2 24/16 Roof (min.), 24/16 Floor (min.); or equalMicrolams ………………………………………Fb = 2600 psi, *E = 1.9 x 106 psi, *Multiplication factors apply per mfr. SpecsBolts……………………..…………………………ASTM A307, Fy = 33 ksi6DCBA354321654321REVISIONS:Architects, P.C.Designed By:CHARETTE ASSOCIATESNotice:The drawings, plans, specifications and designs contained herein are and shall remain the exclusive property of Charette Associates Architects, P.C., and cannot be altered, copied, duplicated or used directly or indirectly in whole or in part except with the express written permission of Charette Associates Architects, P.C. Copyright 2023PROJECTDESIGNEDDRAWNDRAWING TITLESEALCHECKEDAPPROVEDDATEPROJECT NO.SCALEDRAWING NO.Gansevoort, New YorkPhone (518) 265-2628 Fax (518) 581-053012" = 1'-0"RENOVATE APARTMENT #9282 Ballston AvenueSaratoga Springs, NY 12866MATERIAL SPECS & STRUCT. NOTESA-8012301LALALAJK/AK12/28/23SCALE:N.T.S.STRUCTURAL NOTESA5